Overview

  • Product name

  • Description

    Rabbit polyclonal to USP30
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human USP30 aa 101-400.
    Sequence:

    SQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDASCLLDVLRMY RWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITP KQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDS LSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEK VEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLM MDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQ


    Database link: Q70CQ3

  • Positive control

    • WB: Mouse lung lysate. IHC-P: Human colon cancer and breast cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab235299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 59 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    May participate in the maintenance of mitochondrial morphology.
  • Tissue specificity

    Expressed in skeletal muscle, pancreas, liver and kidney.
  • Sequence similarities

    Belongs to the peptidase C19 family.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deubiquitinating enzyme 30 antibody
    • FLJ40511 antibody
    • Ub-specific protease 30 antibody
    • Ubiquitin carboxyl terminal hydrolase 30 antibody
    • Ubiquitin carboxyl-terminal hydrolase 30 antibody
    • Ubiquitin specific peptidase 30 antibody
    • Ubiquitin specific processing protease 30 antibody
    • Ubiquitin thioesterase 30 antibody
    • Ubiquitin thiolesterase 30 antibody
    • Ubiquitin-specific-processing protease 30 antibody
    • UBP30_HUMAN antibody
    • usp30 antibody
    see all

Images

  • Anti-USP30 antibody (ab235299) at 1/500 dilution + Mouse lung lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 59 kDa

  • Paraffin-embedded human colon cancer tissue stained for USP30 using ab235299 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for USP30 using ab235299 at 1/100 dilution in immunohistochemical analysis.

References

ab235299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up