Overview

  • Product name

    Anti-USP30 antibody [CL4438]
    See all USP30 primary antibodies
  • Description

    Mouse monoclonal [CL4438] to USP30
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human USP30 aa 290-433.
    Sequence:

    IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKR HEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTP VLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST


    Database link: Q70CQ3

  • Epitope

    Binds to an epitope located within the peptide sequence GHKPSQHNPK as determined by overlapping synthetic peptides.
  • Positive control

    • Human testis, kidney, placenta and cerebellum tissues; USP30 over-expression lysate (co-expressed with myc-DDK tag, 3.1 KDa) in HEK293T cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab219969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 59 kDa.

Target

  • Function

    May participate in the maintenance of mitochondrial morphology.
  • Tissue specificity

    Expressed in skeletal muscle, pancreas, liver and kidney.
  • Sequence similarities

    Belongs to the peptidase C19 family.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deubiquitinating enzyme 30 antibody
    • FLJ40511 antibody
    • Ub-specific protease 30 antibody
    • Ubiquitin carboxyl terminal hydrolase 30 antibody
    • Ubiquitin carboxyl-terminal hydrolase 30 antibody
    • Ubiquitin specific peptidase 30 antibody
    • Ubiquitin specific processing protease 30 antibody
    • Ubiquitin thioesterase 30 antibody
    • Ubiquitin thiolesterase 30 antibody
    • Ubiquitin-specific-processing protease 30 antibody
    • UBP30_HUMAN antibody
    • usp30 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human testis tissue labeling USP30 with ab219969 at 1/200 dilution.

  •  Immunohistochemical analysis of paraffin-embedded human kidney tissue labeling USP30 with ab219969 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human placenta tissue labeling USP30 with ab219969 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human cerebellum tissue labeling USP30 with ab219969 at 1/200 dilution.

  • All lanes : Anti-USP30 antibody [CL4438] (ab219969) at 1/200 dilution

    Lane 1 : Control
    Lane 2 : USP30 over-expression lysate (co-expressed with myc-DDK tag, 3.1 KDa) in HEK293T cells

    Predicted band size: 59 kDa

References

ab219969 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up