Overview

  • Product name

  • Description

    Rabbit polyclonal to USP37
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human USP37 aa 1-300.
    Sequence:

    MSPLKIHGPIRIRSMQTGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRI FQLSHNIKNVVLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLD AVHQNRLPAAMKPSQGSGSFGAILGSRTSQKETSRQLSYSDNQASAKRGS LETKDDIPFRKVLGNPGRGSIKTVAGSGIARTIPSLTSTSTPLRSGLLEN RTEKRKRMISTGSELNEDYPKENDSSSNNKAMTDPSRKYLTSSREKQLSL KQSEENRTSGLLPLQSSSFYGSRAGSKEHSSGGTNLDRTNVSSQTPSAKR


    Database link: Q86T82

  • Positive control

    • U2OS cells transfected with USP37 siRNA lysate, Mouse embryo fibroblasts cell lysate and INS1 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab190184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 110 kDa.

Target

  • Tissue specificity

    Expressed in brain and prostate.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 3 UIM (ubiquitin-interacting motif) repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deubiquitinating enzyme 3 antibody
    • Deubiquitinating enzyme 37 antibody
    • EC 3.1.2.15 antibody
    • KIAA1594 antibody
    • MGC117261 antibody
    • OTTHUMP00000164146 antibody
    • tmp_locus_50 antibody
    • Ubiquitin carboxyl-terminal hydrolase 37 antibody
    • Ubiquitin specific peptidase 37 antibody
    • Ubiquitin specific processing protease 37 antibody
    • Ubiquitin specific protease 37 antibody
    • Ubiquitin thioesterase 37 antibody
    • Ubiquitin thiolesterase 37 antibody
    • Ubiquitin-specific-processing protease 37 antibody
    • UBP37_HUMAN antibody
    • USP37 antibody
    see all

Images

  • All lanes : Anti-USP37 antibody (ab190184) at 1/2000 dilution

    Lane 1 : Human U2OS cell lysate si Control
    Lane 2 : Human U2OS cells transfected with USP37 siRNA
    Lane 3 : Mouse Embryo Fibroblaste cell Lysate
    Lane 4 : Rat INS1 cell lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 110 kDa

  • All lanes : Anti-USP37 antibody (ab190184) at 1/2000 dilution

    Lane 1 : Xenopus laevis crude egg extracts


    Lysates/proteins at 50 µg per lane.

    Predicted band size: 110 kDa

References

This product has been referenced in:

  • Hernández-Pérez S  et al. USP37 deubiquitinates Cdt1 and contributes to regulate DNA replication. Mol Oncol N/A:N/A (2016). WB ; Human . Read more (PubMed: 27296872) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up