Anti-USP37 antibody (ab190184)
Key features and details
- Rabbit polyclonal to USP37
- Suitable for: WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-USP37 antibody
See all USP37 primary antibodies -
Description
Rabbit polyclonal to USP37 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human USP37 aa 1-300.
Sequence:MSPLKIHGPIRIRSMQTGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRI FQLSHNIKNVVLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLD AVHQNRLPAAMKPSQGSGSFGAILGSRTSQKETSRQLSYSDNQASAKRGS LETKDDIPFRKVLGNPGRGSIKTVAGSGIARTIPSLTSTSTPLRSGLLEN RTEKRKRMISTGSELNEDYPKENDSSSNNKAMTDPSRKYLTSSREKQLSL KQSEENRTSGLLPLQSSSFYGSRAGSKEHSSGGTNLDRTNVSSQTPSAKR
Database link: Q86T82 -
Positive control
- U2OS cells transfected with USP37 siRNA lysate, Mouse embryo fibroblasts cell lysate and INS1 cell lysate
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide -
Concentration information loading... -
Purity
Whole antiserum -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab190184 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/2000. Predicted molecular weight: 110 kDa. |
Target
-
Tissue specificity
Expressed in brain and prostate. -
Sequence similarities
Belongs to the peptidase C19 family.
Contains 3 UIM (ubiquitin-interacting motif) repeats. - Information by UniProt
-
Database links
- Entrez Gene: 57695 Human
- Entrez Gene: 319651 Mouse
- Entrez Gene: 316522 Rat
- SwissProt: Q86T82 Human
- SwissProt: Q8C0R0 Mouse
- Unigene: 166068 Human
- Unigene: 471601 Mouse
- Unigene: 66568 Mouse
-
Alternative names
- Deubiquitinating enzyme 3 antibody
- Deubiquitinating enzyme 37 antibody
- EC 3.1.2.15 antibody
see all
Images
-
Western blot - Anti-USP37 antibody (ab190184)All lanes : Anti-USP37 antibody (ab190184) at 1/2000 dilution
Lane 1 : Human U2OS cell lysate si Control
Lane 2 : Human U2OS cells transfected with USP37 siRNA
Lane 3 : Mouse Embryo Fibroblaste cell Lysate
Lane 4 : Rat INS1 cell lysate
Lysates/proteins at 40 µg per lane.
Predicted band size: 110 kDa -
Western blot - Anti-USP37 antibody (ab190184)All lanes : Anti-USP37 antibody (ab190184) at 1/2000 dilution
Lane 1 : Xenopus laevis crude egg extracts
Lysates/proteins at 50 µg per lane.
Predicted band size: 110 kDa
Datasheets and documents
References
ab190184 has been referenced in 3 publications.
- Hong K et al. USP37 promotes deubiquitination of HIF2a in kidney cancer. Proc Natl Acad Sci U S A N/A:N/A (2020). WB ; Human . PubMed: 32461361
- Xiao Z et al. USP37 is a SNAI1 deubiquitinase. Am J Cancer Res 9:2749-2759 (2019). WB ; Human . PubMed: 31911859
- Hernández-Pérez S et al. USP37 deubiquitinates Cdt1 and contributes to regulate DNA replication. Mol Oncol N/A:N/A (2016). WB ; Human . PubMed: 27296872
