Overview

  • Product name

    Anti-USP46 antibody [CL0364]
    See all USP46 primary antibodies
  • Description

    Mouse monoclonal [CL0364] to USP46
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human USP46 aa 112-205.
    Sequence:

    LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENN KPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN


    Database link: P62068

  • Epitope

    Binds to an epitope located within the peptidesequence TNETRCLNCE as determined by overlapping synthetic peptides.
  • Positive control

    • ICC/IF: U-2 OS cells. WB: U-251 MG cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab244215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa.

Target

  • Function

    Deubiquitinating enzyme that plays a role in behavior, possibly by regulating GABA action. May act by mediating the deubiquitination of GAD1/GAD67. Has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2.
  • Tissue specificity

    Broadly expressed.
  • Sequence similarities

    Belongs to the peptidase C19 family. USP12/USP46 subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deubiquitinating enzyme 46 antibody
    • FLJ11850 antibody
    • FLJ12552 antibody
    • FLJ14283 antibody
    • FLJ39393 antibody
    • Ubiquitin carboxyl terminal hydrolase 46 antibody
    • Ubiquitin carboxyl-terminal hydrolase 46 antibody
    • Ubiquitin specific peptidase 46 antibody
    • Ubiquitin specific processing protease 46 antibody
    • Ubiquitin specific protease 46 antibody
    • Ubiquitin thioesterase 46 antibody
    • Ubiquitin thiolesterase 46 antibody
    • Ubiquitin-specific-processing protease 46 antibody
    • UBP46_HUMAN antibody
    • USP46 antibody
    see all

Images

  • A-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for USP46 (green) using ab244215 at 4 µg/ml in ICC/IF. Microtubule and nuclear probes are visualized in red and blue respectively.

  • Anti-USP46 antibody [CL0364] (ab244215) at 1 µg/ml + U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 42 kDa

References

ab244215 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up