Overview

  • Product name

  • Description

    Rabbit polyclonal to USP5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human USP5 aa 201-500.
    Sequence:

    KCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGT ITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDF QRKYVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGE RVPEQKEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMVERN CRSSENPNEVFRFLVEEKIKCLATEKVKYTQRVDYIMQLPVPMDAALNKE


    Database link: P45974

  • Positive control

    • WB: Mouse liver and brain tissue lysate. A549, MCF7, A-375, U-251 MG and HL-60 whole cell lysate. IHC-P: Human kidney and testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 96 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Cleaves linear and branched multiubiquitin polymers with a marked preference for branched polymers. Involved in unanchored 'Lys-48'-linked polyubiquitin disassembly. Binds linear and 'Lys-63'-linked polyubiquitin with a lower affinity. Knock-down of USP5 causes the accumulation of p53/TP53 and an increase in p53/TP53 transcriptional activity because the unanchored polyubiquitin that accumulates is able to compete with ubiquitinated p53/TP53 but not with MDM2 for proteasomal recognition.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 2 UBA domains.
    Contains 1 UBP-type zinc finger.
  • Domain

    The UBP-type zinc finger domain interacts selectively with an unmodified C-terminus of the proximal ubiquitin. Both UBA domains are involved in polyubiquitin recognition.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deubiquitinating enzyme 5 antibody
    • Isopeptidase T antibody
    • ISOT 1 antibody
    • ISOT antibody
    • Ubiquitin carboxyl-terminal hydrolase 5 antibody
    • Ubiquitin isopeptidase T antibody
    • Ubiquitin specific peptidase 5 (isopeptidase T) antibody
    • Ubiquitin specific peptidase 5 antibody
    • Ubiquitin specific processing protease 5 antibody
    • Ubiquitin specific protease 5 (isopeptidase T) antibody
    • Ubiquitin specific protease 5 (ubiquitin isopeptidase T) antibody
    • Ubiquitin thioesterase 5 antibody
    • Ubiquitin thiolesterase 5 antibody
    • Ubiquitin-specific-processing protease 5 antibody
    • UBP5_HUMAN antibody
    • Usp5 antibody
    see all

Images

  • All lanes : Anti-USP5 antibody (ab235772) at 1/1000 dilution

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Mouse brain tissue lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 4 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 5 : A-375 (human malignant melanoma cell line) whole cell lysate
    Lane 6 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 7 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 96 kDa

  • Paraffin-embedded human kidney tissue stained for USP5 with ab235772 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for USP5 with ab235772 at 1/100 dilution in immunohistochemical analysis.

References

ab235772 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up