Anti-USP6 antibody (ab224725)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-USP6 antibody
See all USP6 primary antibodies -
Description
Rabbit polyclonal to USP6 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IF, WBmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment corresponding to Human USP6 aa 1122-1359.
Sequence:PLTPQGDELSKPRILAREVKKVDAQSSAGKEDMLLSKSPSSLSANISSSP KGSPSSSRKSGTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKPSSS KKNLDASKENGAGQICELADALSRGHMRGGSQPELVTPQDHEVALANGFL YEHEACGNGCGDGYSNGQLGNHSEEDSTDDQREDTHIKPIYNLYAISCHS GILSGGHYITYAKNPNCKWYCYNDSSCEELHPDEIDTD
Database link: P35125-1 -
Positive control
- WB: Rat kidney tissue lysate. IHC: Human ovarian cancer tissue. ICC/IF: HepG2 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab224725 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
ICC/IF | 1/50 - 1/200. | |
WB | 1/500 - 1/5000. |
Target
-
Function
Deubiquitinase with an ATP-independent isopeptidase activity, cleaving at the C-terminus of the ubiquitin moiety. Catalyzes its own deubiquitination. In vitro, isoform 2, but not isoform 3, shows deubiquitinating activity. Promotes plasma membrane localization of ARF6 and selectively regulates ARF6-dependent endocytic protein trafficking. Is able to initiate tumorigenesis by inducing the production of matrix metalloproteinases following NF-kappa-B activation. -
Tissue specificity
Testis specific. Expressed in various cancer cell lines. -
Involvement in disease
Note=A chromosomal aberration involving USP6 is a common genetic feature of aneurysmal bone cyst, a benign osseous neoplasm. Translocation t(16;17)(q22;p13) with CDH11. The translocation generates a fusion gene in which the strong CDH11 promoter is fused to the entire USP6 coding sequence, resulting in USP6 transcriptional up-regulation. -
Sequence similarities
Belongs to the peptidase C19 family.
Contains 1 Rab-GAP TBC domain. -
Domain
The Rab-GAP TBC domain lacks GTPase activator activity but is necessary for interaction with ARF6. -
Post-translational
modificationsMonubiquitinated; ubiquitination is calmodulin and calcium dependent. -
Cellular localization
Cell membrane. Cytoplasm. Endosome. Localizes to the plasma membrane and to filamentous structures within the cell corresponding to ARF6 regulated tubular endosomes. Activation of RAC1 and CDC42 can direct the relocalization of USP6 to the plasma membrane in a manner that depends on the integrity of the actin cytoskeleton. - Information by UniProt
-
Database links
- Entrez Gene: 9098 Human
- Omim: 604334 Human
- SwissProt: P35125 Human
- Unigene: 448851 Human
-
Alternative names
- Deubiquitinating enzyme 6 antibody
- HRP1 antibody
- Proto-oncogene TRE-2 antibody
see all
Images
-
Anti-USP6 antibody (ab224725) at 1/500 dilution + rat kidney tissue lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution
Observed band size: 159 kDa why is the actual band size different from the predicted? -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-USP6 antibody (ab224725)
Paraffin embedded human ovarian cancer tissue stained for USP6 with ab224725 (1/100 dilution) in immunohistochemical analysis.
-
HepG2 (human liver hepatocellular carcinoma cell line) cells stained for USP6 (green) using ab224725 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).
References
ab224725 has not yet been referenced specifically in any publications.