For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    By product type
    Proteins and Peptides
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Lysates
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    • Protocols & troubleshooting
    • Technical FAQs
    • Get technical help
    • RabMAb Advantages
    • Buying FAQs
    • Antibody Guide
    • Scientific webinars
    • Biochemical product FAQ
    • Support resources
    • eProcurement
    Check out our protocols

    Visit protocols and troubleshooting or check them out using the Abcam app for iPhone

    Protocols and troubleshooting

    iPhone app

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    usp6-antibody-ab224725.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Deubiquitination
Share by email

Anti-USP6 antibody (ab224725)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

  • Western blot - Anti-USP6 antibody (ab224725)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-USP6 antibody (ab224725)
  • Immunocytochemistry/ Immunofluorescence - Anti-USP6 antibody (ab224725)

Add compatible products

Primary

Product image

 

Secondary

Product image

 

Protein

Product image

 

Unfortunately, one or more of the products below are unavailable in your country/region.

Sorry, we can't display this right now.
Please contact us to place your order, or try again later.

View more associated products

  • Datasheet
  • References
  • Protocols

Overview

  • Product name

    Anti-USP6 antibody
    See all USP6 primary antibodies
  • Description

    Rabbit polyclonal to USP6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human USP6 aa 1122-1359.
    Sequence:

    PLTPQGDELSKPRILAREVKKVDAQSSAGKEDMLLSKSPSSLSANISSSP KGSPSSSRKSGTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKPSSS KKNLDASKENGAGQICELADALSRGHMRGGSQPELVTPQDHEVALANGFL YEHEACGNGCGDGYSNGQLGNHSEEDSTDDQREDTHIKPIYNLYAISCHS GILSGGHYITYAKNPNCKWYCYNDSSCEELHPDEIDTD


    Database link: P35125-1

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Rat kidney tissue lysate. IHC: Human ovarian cancer tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Deubiquitination
    • Epigenetics and Nuclear Signaling
    • Ubiquitin & Ubiquitin Like Modifiers
    • Deubiquitination

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human USP6 protein (ab160339)

Applications

Our Abpromise guarantee covers the use of ab224725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000.

Target

  • Function

    Deubiquitinase with an ATP-independent isopeptidase activity, cleaving at the C-terminus of the ubiquitin moiety. Catalyzes its own deubiquitination. In vitro, isoform 2, but not isoform 3, shows deubiquitinating activity. Promotes plasma membrane localization of ARF6 and selectively regulates ARF6-dependent endocytic protein trafficking. Is able to initiate tumorigenesis by inducing the production of matrix metalloproteinases following NF-kappa-B activation.
  • Tissue specificity

    Testis specific. Expressed in various cancer cell lines.
  • Involvement in disease

    Note=A chromosomal aberration involving USP6 is a common genetic feature of aneurysmal bone cyst, a benign osseous neoplasm. Translocation t(16;17)(q22;p13) with CDH11. The translocation generates a fusion gene in which the strong CDH11 promoter is fused to the entire USP6 coding sequence, resulting in USP6 transcriptional up-regulation.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 1 Rab-GAP TBC domain.
  • Domain

    The Rab-GAP TBC domain lacks GTPase activator activity but is necessary for interaction with ARF6.
  • Post-translational
    modifications

    Monubiquitinated; ubiquitination is calmodulin and calcium dependent.
  • Cellular localization

    Cell membrane. Cytoplasm. Endosome. Localizes to the plasma membrane and to filamentous structures within the cell corresponding to ARF6 regulated tubular endosomes. Activation of RAC1 and CDC42 can direct the relocalization of USP6 to the plasma membrane in a manner that depends on the integrity of the actin cytoskeleton.
  • Target information above from: UniProt accession P35125 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 9098 Human
    • Omim: 604334 Human
    • SwissProt: P35125 Human
    • Unigene: 448851 Human
    • Alternative names

      • Deubiquitinating enzyme 6 antibody
      • HRP1 antibody
      • Proto-oncogene TRE-2 antibody
      • TRE17 antibody
      • TRE2 antibody
      • Ubiquitin carboxyl-terminal hydrolase 6 antibody
      • Ubiquitin specific protease 6 antibody
      • Ubiquitin thiolesterase 6 antibody
      • Ubiquitin-specific-processing protease 6 antibody
      • UBP6_HUMAN antibody
      • USP6 antibody
      see all

    Images

    • Western blot - Anti-USP6 antibody (ab224725)
      Western blot - Anti-USP6 antibody (ab224725)
      Anti-USP6 antibody (ab224725) at 1/500 dilution + rat kidney tissue lysate

      Secondary
      Goat polyclonal to rabbit IgG at 1/50000 dilution

      Observed band size: 159 kDa
      why is the actual band size different from the predicted?

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-USP6 antibody (ab224725)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-USP6 antibody (ab224725)

      Paraffin embedded human ovarian cancer tissue stained for USP6 with ab224725 (1/100 dilution) in immunohistochemical analysis.

    • Immunocytochemistry/ Immunofluorescence - Anti-USP6 antibody (ab224725)
      Immunocytochemistry/ Immunofluorescence - Anti-USP6 antibody (ab224725)

      HepG2 (human liver hepatocellular carcinoma cell line) cells stained for USP6 (green) using ab224725 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

    Datasheets and documents

    • Datasheet
    • SDS
  • References

    ab224725 has not yet been referenced specifically in any publications.

    Publishing research using ab224725? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab224725.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & advice
    • Buying FAQs
    • RabMAb products
    • Biochemical product FAQs
    Company
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2019 Abcam plc. All rights reserved.