Overview

  • Product name

    Anti-USP6 antibody - C-terminal
    See all USP6 primary antibodies
  • Description

    Rabbit polyclonal to USP6 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human USP6 aa 975-1024 (C terminal). The exact sequence is proprietary.
    Sequence:

    NHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYITYAKNPNCKWY


    Database link: P35125-2

  • Positive control

    • Jurkat whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 122 kDa.

Target

  • Function

    Deubiquitinase with an ATP-independent isopeptidase activity, cleaving at the C-terminus of the ubiquitin moiety. Catalyzes its own deubiquitination. In vitro, isoform 2, but not isoform 3, shows deubiquitinating activity. Promotes plasma membrane localization of ARF6 and selectively regulates ARF6-dependent endocytic protein trafficking. Is able to initiate tumorigenesis by inducing the production of matrix metalloproteinases following NF-kappa-B activation.
  • Tissue specificity

    Testis specific. Expressed in various cancer cell lines.
  • Involvement in disease

    Note=A chromosomal aberration involving USP6 is a common genetic feature of aneurysmal bone cyst, a benign osseous neoplasm. Translocation t(16;17)(q22;p13) with CDH11. The translocation generates a fusion gene in which the strong CDH11 promoter is fused to the entire USP6 coding sequence, resulting in USP6 transcriptional up-regulation.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 1 Rab-GAP TBC domain.
  • Domain

    The Rab-GAP TBC domain lacks GTPase activator activity but is necessary for interaction with ARF6.
  • Post-translational
    modifications

    Monubiquitinated; ubiquitination is calmodulin and calcium dependent.
  • Cellular localization

    Cell membrane. Cytoplasm. Endosome. Localizes to the plasma membrane and to filamentous structures within the cell corresponding to ARF6 regulated tubular endosomes. Activation of RAC1 and CDC42 can direct the relocalization of USP6 to the plasma membrane in a manner that depends on the integrity of the actin cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deubiquitinating enzyme 6 antibody
    • HRP1 antibody
    • Proto-oncogene TRE-2 antibody
    • TRE17 antibody
    • TRE2 antibody
    • Ubiquitin carboxyl-terminal hydrolase 6 antibody
    • Ubiquitin specific protease 6 antibody
    • Ubiquitin thiolesterase 6 antibody
    • Ubiquitin-specific-processing protease 6 antibody
    • UBP6_HUMAN antibody
    • USP6 antibody
    see all

Images

  • Anti-USP6 antibody - C-terminal (ab179751) at 1 µg/ml + Jurkat whole cell lysate at 10 µg

    Predicted band size: 122 kDa

References

This product has been referenced in:

  • Zeng H  et al. As an independent prognostic factor, USP6 promotes the invasion and metastasis of colon cancer. Biochem Biophys Res Commun 505:816-822 (2018). Read more (PubMed: 30297112) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up