Overview

  • Product name

  • Description

    Rabbit polyclonal to Uteroglobin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Mouse Uteroglobin aa 30-70 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLP


    Database link: Q06318

  • Positive control

    • IHC-P; rat lung tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217304 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
  • Tissue specificity

    Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways).
  • Sequence similarities

    Belongs to the secretoglobin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Blastokinin antibody
    • CC10 antibody
    • CC16 antibody
    • CCPBP antibody
    • CCSP antibody
    • Clara cell phospholipid binding protein antibody
    • Clara cell phospholipid-binding protein antibody
    • Clara cell specific 10 kD protein antibody
    • Clara cells 10 kDa secretory protein antibody
    • OTTHUMP00000236107 antibody
    • SCGB1A1 antibody
    • Secretoglobin family 1A member 1 antibody
    • Secretoglobin, family 1A, member 1 (uteroglobin) antibody
    • UG antibody
    • UGB antibody
    • UP-1 antibody
    • UP1 antibody
    • Urinary protein 1 antibody
    • Urine protein 1 antibody
    • UTER_HUMAN antibody
    • Uteroglobin antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat lung tissue labeling Uteroglobin with ab217304 at 1/100 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab217304 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217304.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up