Anti-Uteroglobin antibody [C2] (ab239472)

Mouse monoclonal Uteroglobin antibody [C2]. Validated in WB, IHC and tested in Human, Pig. Immunogen corresponding to recombinant fragment.

Overview

  • Product name

    Anti-Uteroglobin antibody [C2]
    See all Uteroglobin primary antibodies
  • Description

    Mouse monoclonal [C2] to Uteroglobin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Uteroglobin aa 23-91. N-terminal His-tag. (Expressed in E.coli).
    Sequence:

    ICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLPQK PRESIIKLMEKIAQSSLCN


    Database link: P11684

  • Positive control

    • IHC-P: Human cerebrum tissue. WB: Pig lung lysate; Recombinant human Uteroglobin protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    C2
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 10 kDa.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Function

    Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
  • Tissue specificity

    Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways).
  • Sequence similarities

    Belongs to the secretoglobin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Blastokinin antibody
    • CC10 antibody
    • CC16 antibody
    • CCPBP antibody
    • CCSP antibody
    • Clara cell phospholipid binding protein antibody
    • Clara cell phospholipid-binding protein antibody
    • Clara cell specific 10 kD protein antibody
    • Clara cells 10 kDa secretory protein antibody
    • OTTHUMP00000236107 antibody
    • SCGB1A1 antibody
    • Secretoglobin family 1A member 1 antibody
    • Secretoglobin, family 1A, member 1 (uteroglobin) antibody
    • UG antibody
    • UGB antibody
    • UP-1 antibody
    • UP1 antibody
    • Urinary protein 1 antibody
    • Urine protein 1 antibody
    • UTER_HUMAN antibody
    • Uteroglobin antibody
    see all

Images

  • Paraffin-embedded human cerebrum tissue stained for Uteroglobin using ab239472 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Uteroglobin antibody [C2] (ab239472) at 5 µg/ml + Pig lung tissue lysate

    Predicted band size: 10 kDa

  • Anti-Uteroglobin antibody [C2] (ab239472) at 5 µg/ml + Recombinant human Uteroglobin protein

    Predicted band size: 10 kDa

References

ab239472 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up