Anti-UTP11L antibody (ab247068)
Key features and details
- Rabbit polyclonal to UTP11L
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-UTP11L antibody -
Description
Rabbit polyclonal to UTP11L -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human UTP11L aa 80-161.
Sequence:HIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQ GKQQNKHVFFFDTKKEVEQFDVATHLQTAPEL
Database link: Q9Y3A2 -
Positive control
- WB: Human plasma (IgG/HSA depleted). IHC-P: Human cerebellum tissue. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab247068 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 30 kDa. |
Target
-
Function
Involved in nucleolar processing of pre-18S ribosomal RNA. -
Sequence similarities
Belongs to the UTP11 family. -
Cellular localization
Nucleus > nucleolus. - Information by UniProt
-
Database links
- Entrez Gene: 51118 Human
- Entrez Gene: 67205 Mouse
- Omim: 609440 Human
- SwissProt: Q9Y3A2 Human
- SwissProt: Q9CZJ1 Mouse
- SwissProt: Q8R5K5 Rat
- Unigene: 472038 Human
- Unigene: 637686 Human
see all -
Alternative names
- CGI 94 antibody
- CGI94 antibody
- Probable U3 small nucleolar RNA associated protein 11 antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for UTP11L (green) using ab247068 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-UTP11L antibody (ab247068)Paraffin-embedded human cerebellum tissue stained for UTP11L using ab247068 at 1/50 dilution in immunohistochemical analysis.
-
All lanes : Anti-UTP11L antibody (ab247068) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Predicted band size: 30 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab247068 has not yet been referenced specifically in any publications.