Overview

  • Product name

    Anti-UTP23 antibody
  • Description

    Rabbit polyclonal to UTP23
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human UTP23 aa 1-249.
    Sequence:

    MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLP RYLMGETQLCTTRCVLKELETLGKDLYGAKLIAQKCQVRNCPHFKNAVSG SECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFIIQNTMVLDKP SPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKIS GPNPLSCLKKKKKAPDTQSSASEKKRKRKRIRNRSNPKVLSEKQNAEGE


    Database link: Q9BRU9-1

  • Positive control

    • WB: Mouse liver lysate. IHC-P: Human liver cancer and adrenal gland tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235327 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 28 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in rRNA-processing and ribosome biogenesis.
  • Sequence similarities

    Belongs to the UTP23/FCF1 family. UTP23 subfamily.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1700010I21Rik antibody
    • AI662478 antibody
    • BB238373 antibody
    • C8orf53 antibody
    • D530033C11R antibody
    • MGC14595 antibody
    • RGD1307179 antibody
    • rRNA processing protein UTP23 homolog antibody
    • rRNA-processing protein UTP23 homolog antibody
    • UTP 23 antibody
    • utp23 antibody
    • UTP23 small subunit (SSU) processome component homolog (yeast) antibody
    • UTP23_HUMAN antibody
    see all

Images

  • Anti-UTP23 antibody (ab235327) at 1/500 dilution + Mouse liver tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 28 kDa

  • Paraffin-embedded human liver cancer tissue stained for UTP23 using ab235327 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for UTP23 using ab235327 at 1/100 dilution in immunohistochemical analysis.

References

ab235327 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235327.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up