Overview

  • Product name

  • Description

    Rabbit polyclonal to v-Myb
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human v-Myb aa 503-752.
    Sequence:

    IENPSFTSTPICGQKALITTPLHKETTPKDQKENVGFRTPTIRRSILGTT PRTPTPFKNALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLFLK EEDEPAYKSCKQENTASGKKVRKSLVLDNWEKEESGTQLLTEDISDMQSE NRFTTSLLMIPLLEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTSKV VKLEKNLQSNCEWETVVYGKTEDQLIMTEQARRYLSTYTATSSTSRALIL


    Database link: P10243-1

  • Positive control

    • IHC-P: Human testis and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
  • Tissue specificity

    Expressed in a variety of lymphoid and solid tumor lines cultured in vitro.
  • Sequence similarities

    Contains 3 HTH myb-type DNA-binding domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • A-Myb antibody
    • AMYB antibody
    • MGC120059 antibody
    • MGC120061 antibody
    • Myb related protein A antibody
    • Myb-like protein 1 antibody
    • Myb-related protein A antibody
    • MYBA_HUMAN antibody
    • MYBL1 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for v-Myb using ab234738 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for v-Myb using ab234738 at 1/100 dilution in immunohistochemical analysis.

References

ab234738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up