Overview

  • Product name

    Anti-valyl tRNA synthetase antibody
    See all valyl tRNA synthetase primary antibodies
  • Description

    Rabbit polyclonal to valyl tRNA synthetase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse valyl tRNA synthetase aa 186-421. (Expressed in E.coli)
    Sequence:

    NVTRWFNTCVRQPEFRAVLGEVALYSGARSVTQQPGSEVIAPQKTPAQLK KEAKKREKLEKFQQKQKTQQQPPHGEKKPKPEKKEKRDPGVITYDLPTPP GEKKDVSGAMPDSYSPQYVEAAWYPWWERQGFFKPEYGRPSVSAPNPRGV FMMCIPPPNVTGSLHLGHALTNAIQDSLTRWHRMRGETTLWNPGCDHAGI ATQVVVEKKLWKERGLNRHQLGREAFLEEVWKWKAE


    Database link: Q9Z1Q9

  • Positive control

    • IHC-P: Mouse kidney, ovary and stomach tissue. WB: Recombinant mouse valyl tRNA synthetase protein; Mouse pancreas and liver tissue lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 140 kDa.
IHC-P Use a concentration of 5 - 20 mg/ml.

Target

  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
    Contains 1 GST C-terminal domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Bat 6 antibody
    • Bat6 antibody
    • D17H6S56E antibody
    • EC 6.1.1.9 antibody
    • G7A antibody
    • Protein G7a antibody
    • SYVC_HUMAN antibody
    • valine tRNA ligase 1, cytoplasmic antibody
    • Valine tRNA ligase antibody
    • Valine--tRNA ligase antibody
    • ValRS antibody
    • VALYL tRNA SYNTHETASE 1 antibody
    • valyl tRNA synthetase 2 antibody
    • valyl-tRNA synthetase 2 antibody
    • Valyl-tRNA synthetase antibody
    • vars antibody
    • Vars1 antibody
    • VARS2 antibody
    • VARS2, formerly antibody
    see all

Images

  • All lanes : Anti-valyl tRNA synthetase antibody (ab231711) at 1 µg/ml

    Lane 1 : Mouse pancreas lysate.
    Lane 2 : Mouse liver lysate.

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 140 kDa

  • Anti-valyl tRNA synthetase antibody (ab231711) at 2 µg/ml + Recombinant mouse valyl tRNA synthetase protein.

    Predicted band size: 140 kDa

  • Formalin-fixed, paraffin-embedded mouse stomach tissue stained for valyl tRNA synthetase using ab231711 at 20µg/mL in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse oavry tissue stained for valyl tRNA synthetase using ab231711 at 20µg/mL in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for valyl tRNA synthetase using ab231711 at 20µg/mL in immunohistochemical analysis.

References

ab231711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up