Overview

  • Product name

  • Description

    Rabbit polyclonal to VAMP5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human VAMP5 aa 1-116.
    Sequence:

    MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSST FNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSS SAPRTQDAGIASGPGN


    Database link: O95183

  • Positive control

    • WB: Human prostate lysate. IHC-P: Human liver cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.05% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab216044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/200. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB 1/1000 - 1/5000. Predicted molecular weight: 12 kDa.

Target

  • Function

    May participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.
  • Sequence similarities

    Belongs to the synaptobrevin family.
    Contains 1 v-SNARE coiled-coil homology domain.
  • Cellular localization

    Cell membrane. Endomembrane system. Golgi apparatus, trans-Golgi network membrane. Associated with the plasma membrane as well as intracellular perinuclear and peripheral vesicular structures of myotubes. Associated with the trans-Golgi, but not with the cis-Golgi apparatus (By similarity).
  • Information by UniProt
  • Database links

  • Alternative names

    • Camp antibody
    • Myobrevin antibody
    • VAMP 5 antibody
    • VAMP-5 antibody
    • VAMP5 antibody
    • VAMP5_HUMAN antibody
    • Vesicle associated membrane protein 5 antibody
    • Vesicle-associated membrane protein 5 antibody
    see all

Images

  • Anti-VAMP5 antibody (ab216044) at 1/650 dilution + Human prostate lysate at 40 µg

    Secondary
    Goat anti rabbit IgG at 1/8000 dilution

    Predicted band size: 12 kDa


    Exposure time: 15 seconds


    Gel: 12% SDS-PAGE.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling VAMP5 with ab216044 at 1/100 dilution.

References

ab216044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up