Overview

  • Product name

  • Description

    Rabbit polyclonal to VANGL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human VANGL1 aa 275-524.
    Sequence:

    AALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQ SRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQR LQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESIL QHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNG LRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV


    Database link: Q8TAA9

  • Positive control

    • WB: PC-3, MCF7 and HeLa whole cell lysates. IHC-P: Human colon cancer and ovarian cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 60 kDa (predicted molecular weight: 60 kDa).

Target

  • Tissue specificity

    Accordiing to PubMed:11956595, ubiquitously expressed. According to PubMed:12011995, expressed specifically in testis and ovary.
  • Involvement in disease

    Defects in VANGL1 are a cause of neural tube defects (NTD) [MIM:182940]. NTD are congenital malformations. The most common forms of NTD are described as open defects (including anencephaly and myelomeningocele, or spina bifida), which result from the failure of fusion in the cranial and spinal region of the neural tube, respectively. Other open dysraphisms (including myeloschisis, hemimyelomeningocele, and hemimyelocele) are sometimes associated with a Chiari type 2 malformation. A number of skin-covered (closed) NTD are categorized clinically depending on the presence of a subcutaneous mass (lipomyeloschisis, lipomyelomeningocele, meningocele, and myelocystocele) or the absence of such a mass (complex dysraphic states, including split cord malformations, dermal sinus, caudal regression, and segmental spinal dysgenesis).
    Defects in VANGL1 are a cause of sacral defect with anterior meningocele (SDAM) [MIM:600145]. SDAM is a form of caudal dysgenesis. It is present at birth and becomes symptomatic later in life, usually because of obstructive labor in females, chronic constipation, or meningitis. Inheritance is autosomal dominant.
  • Sequence similarities

    Belongs to the Vang family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANGL planar cell polarity protein 1 antibody
    • KAI1 C-terminal interacting tetraspanin antibody
    • KITENIN antibody
    • Loop tail protein 2 homolog antibody
    • Loop-tail protein 2 homolog antibody
    • LPP2 antibody
    • MGC5338 antibody
    • STB2 antibody
    • STBM2 antibody
    • Strabismus 2 antibody
    • Strabismus, Drosophila, homolog of, 2 antibody
    • Van Gogh like protein 1 antibody
    • Van Gogh, Drosophila, homolog of, 1 antibody
    • Van Gogh-like protein 1 antibody
    • Vang like 1 (van gogh, Drosophila) antibody
    • Vang like protein 1 antibody
    • Vang-like 1 antibody
    • Vang-like protein 1 antibody
    • VANG1_HUMAN antibody
    • VANGL 1 antibody
    • Vangl1 antibody
    see all

Images

  • All lanes : Anti-VANGL1 antibody (ab229743) at 1/1000 dilution

    Lane 1 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 60 kDa
    Observed band size: 60 kDa

  • Paraffin-embedded human colon cancer tissue stained for VANGL1 using ab229743 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovarian cancer tissue stained for VANGL1 using ab229743 at 1/100 dilution in immunohistochemical analysis.

References

ab229743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up