Overview

  • Product name

  • Description

    Mouse polyclonal to VAPA
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human VAPA aa 8-249. (ENSP00000217602).
    Sequence:

    MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPR RYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTS DMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDG PMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVA HSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL


    Database link: Q9P0L0

  • Positive control

    • VAPA transfected 293T lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27.3 kDa.

Target

  • Function

    May play a role in vesicle trafficking.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family.
    Contains 1 MSP domain.
  • Cellular localization

    Endoplasmic reticulum membrane. Present in the plasma membrane and in intracellular vesicles, together with SNARE proteins. May also associate with the cytoskeleton. Colocalizes with OCLN at the tight junction in polarized epithelial cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • 33 kDa Vamp-associated protein antibody
    • hVAP 33 antibody
    • MGC3745 antibody
    • OTTHUMP00000162362 antibody
    • OTTHUMP00000162363 antibody
    • VAMP (vesicle-associated membrane protein) associated protein A, 33kDa antibody
    • VAMP A antibody
    • VAMP associated protein A antibody
    • VAMP-A antibody
    • VAMP-associated protein A antibody
    • VAP 33 antibody
    • VAP A antibody
    • VAP-33 antibody
    • VAP-A antibody
    • VAP33 antibody
    • Vapa antibody
    • VAPA_HUMAN antibody
    • Vesicle associated membrane protein associated protein A antibody
    • Vesicle-associated membrane protein-associated protein A antibody
    see all

Images

  • All lanes : Anti-VAPA antibody (ab172371) at 1 µg/ml

    Lane 1 : VAPA transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 27.3 kDa

References

ab172371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (Megakaryocyte)
Permeabilization
Yes - 1%Triton X-100
Specification
Megakaryocyte
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 20°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jan 02 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up