Overview

  • Product name

    Anti-VAPB antibody [MM0949-33M9]
    See all VAPB primary antibodies
  • Description

    Mouse monoclonal [MM0949-33M9] to VAPB
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human VAPB aa 2-130.
    Sequence:

    AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRR YCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSD MEAVWKEAKPEDLMDSKLRCVFELPAEND


    Database link: O95292

Properties

Applications

Our Abpromise guarantee covers the use of ab201634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 27 kDa.
Flow Cyt Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/50 - 1/100.

Target

  • Relevance

    VAPB contains 1 MSP domain and it may play a role in vesicle trafficking. Defects in VAPB are a cause of proximal adult autosomal dominant spinal muscular atrophy [MIM:182980]; also called late onset spinal muscular atrophy Finkel type. Spinal muscular atrophies are neurodegenerative disorders characterized by degeneration of lower motor neurons, leading to progressive paralysis muscular atrophy. This form is a late adult onset form of the disease (after age 20 years). The patients show a benign course, most of them remaining ambulatory 10 to 40 years after clinical onset.
  • Cellular localization

    Cell membrane; Single-pass type IV membrane. Intracytoplasmic membrane; Single-pass type IV membrane protein. Note: Present in the plasma membrane and in intracellular vesicles.
  • Database links

  • Alternative names

    • ALS 8 antibody
    • ALS8 antibody
    • D2Abb2e antibody
    • UNQ484/PRO983 antibody
    • Vamp 33b antibody
    • VAMP associated 33 kDa protein antibody
    • VAMP associated protein B and C antibody
    • VAMP associated protein B antibody
    • VAMP associated protein B/C antibody
    • VAMP associated protein C antibody
    • VAMP B antibody
    • VAMP B VAMP C antibody
    • VAMP B/VAMP C antibody
    • VAMP C antibody
    • VAMP vesicle associated membrane protein associated protein B and C antibody
    • Vamp33b antibody
    • VAMPB antibody
    • VAMPB/VAMPC antibody
    • VAMPC antibody
    • VAP 33b antibody
    • VAP B antibody
    • VAP B/VAP C antibody
    • VAP C antibody
    • VAP33b antibody
    • VAPB/VAPC antibody
    • VAPC antibody
    • Vesicle associated membrane protein associated protein B and C antibody
    • Vesicle associated membrane protein associated protein B/C antibody
    see all

Images

References

ab201634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up