Overview

  • Product name

    Anti-VASH1 antibody [4A3]
    See all VASH1 primary antibodies
  • Description

    Mouse monoclonal [4A3] to VASH1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human VASH1 aa 3-101. (NP_055724).
    Sequence:

    GGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEED LRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDL


    Database link: Q7L8A9

  • Positive control

    • Human placenta tissue; HepG2 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    4A3
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab219790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 3 - 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB Use at an assay dependent concentration. Predicted molecular weight: 41 kDa.

Target

  • Function

    Angiogenesis inhibitor. Inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. Does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. Acts in an autocrine manner. Inhibits artery neointimal formation and macrophage infiltration. Exhibits heparin-binding activity.
  • Tissue specificity

    Preferentially expressed in endothelial cells. Highly expressed in fetal organs. Expressed in brain and placenta, and at lower level in heart and kidney. Highly detected in microvessels endothelial cells of atherosclerotic lesions.
  • Sequence similarities

    Belongs to the vasohibin family.
  • Post-translational
    modifications

    2 major forms (42 and 36 kDa) and 2 minors (32 and 27 kDa) may be processed by proteolytic cleavage. The largest form (42 kDa) seems to be secreted and the other major form (63 kDa) seems to accumulate within the cells or pericellular milieu. Polypeptide consisting of Met-77 to Arg-318 may correspond to the 27 kDa form and that consisting of Met-77 to Val-365 may correspond to the 36 kDa form.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1036 antibody
    • VASH antibody
    • VASH1 antibody
    • VASH1_HUMAN antibody
    • Vasohibin 1 antibody
    • Vasohibin-1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human placenta tissue labeling VASH1 with ab219790 at 10 µg/ml.

  • Anti-VASH1 antibody [4A3] (ab219790) + HepG2 cell lysate

    Predicted band size: 41 kDa

References

ab219790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up