Overview

  • Product name

    Anti-VASP antibody - C-terminal
    See all VASP primary antibodies
  • Description

    Rabbit polyclonal to VASP - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rabbit, Horse, Cat, Dog, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Common marmoset, Orangutan, African bush elephant, Bat
  • Immunogen

    Synthetic peptide within Human VASP aa 330-380 (C terminal). The exact sequence is proprietary.
    Sequence:

    ETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVKEEIIEAFVQELRKRGS P


    Database link: P50552

  • Positive control

    • HeLa, 293T, Jurkat, TCMK1 and NIH 3T3 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab205952 was affinity purified using an epitope specific to VASP immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab205952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 39 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function

    Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance, lamellipodial and filopodial dynamics, platelet activation and cell migration. VASP promotes actin filament elongation. It protects the barbed end of growing actin filaments against capping and increases the rate of actin polymerization in the presence of capping protein. VASP stimulates actin filament elongation by promoting the transfer of profilin-bound actin monomers onto the barbed end of growing actin filaments. Plays a role in actin-based mobility of Listeria monocytogenes in host cells. Regulates actin dynamics in platelets and plays an important role in regulating platelet aggregation.
  • Tissue specificity

    Highly expressed in platelets.
  • Sequence similarities

    Belongs to the Ena/VASP family.
    Contains 1 WH1 domain.
  • Domain

    The EVH2 domain is comprised of 3 regions. Block A is a thymosin-like domain required for G-actin binding. The KLKR motif within this block is essential for the G-actin binding and for actin polymerization. Block B is required for F-actin binding and subcellular location, and Block C for tetramerization.
    The WH1 domain mediates interaction with XIRP1.
  • Post-translational
    modifications

    Major substrate for cAMP-dependent (PKA) and cGMP-dependent protein kinase (PKG) in platelets. The preferred site for PKA is Ser-157, the preferred site for PKG, Ser-239. In ADP-activated platelets, phosphorylation by PKA or PKG on Ser-157 leads to fibrinogen receptor inhibition. Phosphorylation on Thr-278 requires prior phosphorylation on Ser-157 and Ser-239. In response to phorbol ester (PMA) stimulation, phosphorylated by PKC/PRKCA. In response to thrombin, phosphorylated by both PKC and ROCK1. Phosphorylation at Thr-278 by AMPK does not require prior phosphorylation at Ser-157 or Ser-239. Phosphorylation modulates F-actin binding, actin filament elongation and platelet activation. Carbon monoxide (CO) promotes phosphorylation at Ser-157, while nitric oxide (NO) promotes phosphorylation at Ser-157, but also at Ser-239. Response to NO and CO is blunted in platelets from diabetic patients, and VASP is not phosphorylated efficiently at Ser-157 and Ser-239.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Cell junction > focal adhesion. Cell projection > lamellipodium membrane. Cell projection > filopodium membrane. Targeted to stress fibers and focal adhesions through interaction with a number of proteins including MRL family members. Localizes to the plasma membrane in protruding lamellipodia and filopodial tips. Stimulation by thrombin or PMA, also translocates VASP to focal adhesions. Localized along the sides of actin filaments throughout the peripheral cytoplasm under basal conditions.
  • Information by UniProt
  • Database links

  • Alternative names

    • Vasodilator stimulated phosphoprotein antibody
    • Vasodilator-stimulated phosphoprotein antibody
    • VASP antibody
    • VASP_HUMAN antibody

Images

  • All lanes : Anti-VASP antibody - C-terminal (ab205952) at 0.4 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 39 kDa


    Exposure time: 30 seconds
  • All lanes : Anti-VASP antibody - C-terminal (ab205952) at 0.4 µg/ml

    Lane 1 : TCMK1 whole cell lysate
    Lane 2 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 39 kDa


    Exposure time: 3 minutes
  • Detection of VASP in immunoprecipitates of 293T whole cell lysates (0.5 or 1 mg for IP, 20% of IP loaded) using ab205952 at 6 µg/mg lysate for IP and 0.4 µg/ml for WB detection (lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 30 seconds.

References

This product has been referenced in:

  • Zhan R  et al. Nitric oxide induces epidermal stem cell de-adhesion by targeting integrin ß1 and Talin via the cGMP signalling pathway. Nitric Oxide 78:1-10 (2018). WB . Read more (PubMed: 29698689) »
See 1 Publication for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Dog Cell lysate - whole cell (MDCK (Madin-Darby Canine Kidney) cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
20 µg
Treatment
With non specific shRNA or VASP sh RNA
Specification
MDCK (Madin-Darby Canine Kidney) cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Nov 18 2019

Application
Western blot
Sample
Mouse Tissue lysate - whole (Heart)
Gel Running Conditions
Reduced Denaturing (10%)
Loading amount
20 µg
Specification
Heart
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C

Abcam user community

Verified customer

Submitted Jun 16 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up