Anti-VASP antibody [OTI1H8] (ab114029)

Submit a review Submit a question

Overview

  • Product name

    Anti-VASP antibody [OTI1H8]
    See all VASP primary antibodies

  • Description

    Mouse monoclonal [OTI1H8] to VASP

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, Flow Cyt, ICC/IFmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant full length protein corresponding to Human VASP aa 2-380. Produced in HEK-293T cells. NP_003361
    Sequence:

    SETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVG RKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQ FAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVEQQKRQQPGPSEH IERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAG GGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSKQEEASGGPTAP KAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPA QSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQEL LEEVKKELQKVKEEIIEAFVQELRKRGSP


    Database link: P50552

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY VASP cDNA; HepG2, HeLa, MCF7, HT-29 and A549 cell extracts; ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY VASP; FC: HEK-293T cells transfected with pCMV6-ENTRY VASP overexpress plasmid.

  • General notes

    The clone number has been updated from 1H8 to OTI1H8, both clone numbers name the same clone.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...

  • Purity

    Affinity purified

  • Purification notes

    Purified from cell culture supernatant by affinity chromatography

  • Clonality

    Monoclonal

  • Clone number

    OTI1H8

  • Isotype

    IgG1

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab114029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 40 kDa.
Flow Cyt 1/100.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
ICC/IF 1/100.

Target

  • Function

    Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance, lamellipodial and filopodial dynamics, platelet activation and cell migration. VASP promotes actin filament elongation. It protects the barbed end of growing actin filaments against capping and increases the rate of actin polymerization in the presence of capping protein. VASP stimulates actin filament elongation by promoting the transfer of profilin-bound actin monomers onto the barbed end of growing actin filaments. Plays a role in actin-based mobility of Listeria monocytogenes in host cells. Regulates actin dynamics in platelets and plays an important role in regulating platelet aggregation.

  • Tissue specificity

    Highly expressed in platelets.

  • Sequence similarities

    Belongs to the Ena/VASP family.
    Contains 1 WH1 domain.

  • Domain

    The EVH2 domain is comprised of 3 regions. Block A is a thymosin-like domain required for G-actin binding. The KLKR motif within this block is essential for the G-actin binding and for actin polymerization. Block B is required for F-actin binding and subcellular location, and Block C for tetramerization.
    The WH1 domain mediates interaction with XIRP1.

  • Post-translational
    modifications

    Major substrate for cAMP-dependent (PKA) and cGMP-dependent protein kinase (PKG) in platelets. The preferred site for PKA is Ser-157, the preferred site for PKG, Ser-239. In ADP-activated platelets, phosphorylation by PKA or PKG on Ser-157 leads to fibrinogen receptor inhibition. Phosphorylation on Thr-278 requires prior phosphorylation on Ser-157 and Ser-239. In response to phorbol ester (PMA) stimulation, phosphorylated by PKC/PRKCA. In response to thrombin, phosphorylated by both PKC and ROCK1. Phosphorylation at Thr-278 by AMPK does not require prior phosphorylation at Ser-157 or Ser-239. Phosphorylation modulates F-actin binding, actin filament elongation and platelet activation. Carbon monoxide (CO) promotes phosphorylation at Ser-157, while nitric oxide (NO) promotes phosphorylation at Ser-157, but also at Ser-239. Response to NO and CO is blunted in platelets from diabetic patients, and VASP is not phosphorylated efficiently at Ser-157 and Ser-239.

  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Cell junction > focal adhesion. Cell projection > lamellipodium membrane. Cell projection > filopodium membrane. Targeted to stress fibers and focal adhesions through interaction with a number of proteins including MRL family members. Localizes to the plasma membrane in protruding lamellipodia and filopodial tips. Stimulation by thrombin or PMA, also translocates VASP to focal adhesions. Localized along the sides of actin filaments throughout the peripheral cytoplasm under basal conditions.
  • Information by UniProt

  • Database links

    • Alternative names

      • Vasodilator stimulated phosphoprotein antibody
      • Vasodilator-stimulated phosphoprotein antibody
      • VASP antibody
      • VASP_HUMAN antibody

    Images

    • Western blot - Anti-VASP antibody [OTI1H8] (ab114029)
      Western blot - Anti-VASP antibody [OTI1H8] (ab114029)
      All lanes : Anti-VASP antibody [OTI1H8] (ab114029) at 1/500 dilution

      Lane 1 : HepG2 (Human liver hepatocellular carcinoma cell line) cell extract
      Lane 2 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell extract
      Lane 3 : HT-29 (Human colorectal adenocarcinoma cell line) cell extract
      Lane 4 : A549 (Human lung carcinoma cell line) cell extract
      Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell extract
      Lane 6 : Jurkat (Human T cell leukemia cell line from peripheral blood) cell extract
      Lane 7 : MDCK (Canine kidney cell line) cell extract
      Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell extract
      Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract

      Lysates/proteins at 35 µg per lane.

      Predicted band size: 40 kDa

    • Immunocytochemistry/ Immunofluorescence - Anti-VASP antibody [OTI1H8] (ab114029)
      Immunocytochemistry/ Immunofluorescence - Anti-VASP antibody [OTI1H8] (ab114029)

      ab114029 at 1/100 dilution staining VASP in COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY VASP by Immunofluorescence.

    • Flow Cytometry - Anti-VASP antibody [OTI1H8] (ab114029)
      Flow Cytometry - Anti-VASP antibody [OTI1H8] (ab114029)

      ab114029 at 1/100 dilution staining VASP in HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either pCMV6-ENTRY VASP overexpress plasmid (Red) or empty vector control plasmid (Blue) by flow cytometry.

    • Western blot - Anti-VASP antibody [OTI1H8] (ab114029)
      Western blot - Anti-VASP antibody [OTI1H8] (ab114029)
      All lanes : Anti-VASP antibody [OTI1H8] (ab114029) at 1/500 dilution

      Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
      Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY VASP cDNA

      Lysates/proteins at 5 µg per lane.

      Predicted band size: 40 kDa

    References

    ab114029 has not yet been referenced specifically in any publications.

    Publishing research using ab114029? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab114029.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com