Overview

  • Product name

  • Description

    Rabbit polyclonal to Vaspin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Vaspin aa 20-320.
    Sequence:

    LLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPG RNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYI IHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQN LEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFD PNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNIT AIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDL K


    Database link: Q8IW75

  • Positive control

    • IHC-P: Human epityphlon tissue.
  • General notes

     This product was previously labelled as Vaspin, SERPINA12

     

Properties

Applications

Our Abpromise guarantee covers the use of ab238745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May modulates insulin action conceivably only in the presence of its yet undefined target proteases in white adipose tissues.
  • Tissue specificity

    Expressed in visceral adipose tissues.
  • Sequence similarities

    Belongs to the serpin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ENSG00000165953 antibody
    • OL 64 antibody
    • OL-64 antibody
    • OL64 antibody
    • Serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 12 antibody
    • Serpin A12 antibody
    • Serpin A12 precursor antibody
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 12 antibody
    • Serpina12 antibody
    • SPA12_HUMAN antibody
    • Vaspin antibody
    • Visceral adipose specific serpin antibody
    • Visceral adipose tissue derived serine protease inhibitor antibody
    • Visceral adipose tissue-derived serine protease inhibitor antibody
    • Visceral adipose-specific serpin antibody
    see all

Images

  • Paraffin-embedded human epityphlon tissue stained for Vaspin using ab238745 at 1/100 dilution in immnuohistochemical analysis.

References

ab238745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up