Overview

  • Product name

  • Description

    Rabbit polyclonal to VCAM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Dog
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Dog VCAM1 aa 136-372 (N terminal). Expressed in E. coli. N-terminal tag.
    Sequence:

    TCLVRDVYPFDRLEMNLLNGNDLLQSKDFLEPMEKKSLETKSLEVTFTPT NEDIGKGLVCRAQLHMDEIDFEPKERETTKELQVYISPRNTFISVTPSMR LQEGGSVTMTCASEGLPPPQIFWSKKLDNGNLQLLSGNATLTLIAMRLED SGTYVCEGVNEVGKDGKEVELIVQEKPFTVEISPGPQIIAQIGDSVVLTC GVTDCESPSFSWRTQIDSPLSGTVKVEGAKSTLTLSP


    Database link: Q28260

  • Positive control

    • WB: Mouse lung and kidney lysate. Recombinant canine VCAM1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with the beta-1 integrin VLA4 on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/VLA4 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.
  • Tissue specificity

    Expressed on inflammed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflammed tissue.
  • Sequence similarities

    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain

    Either the first or the fourth Ig-like C2-type domain is required for VLA4-dependent cell adhesion.
  • Post-translational
    modifications

    Sialoglycoprotein.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD106 antibody
    • CD106 Antigen antibody
    • INCAM 100 antibody
    • INCAM-100 antibody
    • L1CAM antibody
    • MGC99561 antibody
    • V-CAM 1 antibody
    • Vascular Cell Adhesion Molecule 1 antibody
    • Vascular cell adhesion protein 1 antibody
    • VCAM 1 antibody
    • VCAM-1 antibody
    • VCAM1 antibody
    • VCAM1_HUMAN antibody
    see all

Images

  • All lanes : Anti-VCAM1 antibody (ab231108) at 2 µg/ml

    Lane 1 : Mouse lung tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Anti-VCAM1 antibody (ab231108) at 2 µg/ml + Recombinant Canine VCAM1 protein

References

ab231108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up