Anti-VCAM1 antibody [VCAM1/843] - BSA and Azide free (ab212938)
Key features and details
- Mouse monoclonal [VCAM1/843] to VCAM1 - BSA and Azide free
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-VCAM1 antibody [VCAM1/843] - BSA and Azide free
See all VCAM1 primary antibodies -
Description
Mouse monoclonal [VCAM1/843] to VCAM1 - BSA and Azide free -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human VCAM1 aa 1-739.
Sequence:MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTT GCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCE SRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEI DLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLH IDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEG LPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQ IDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVEL YSFPRDPEIEMSGGLVNGSSVTVSCKVPSVYPLDRLEIELLKGETILENI EFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHIDDMEFEPKQRQ STQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSRQL PNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSID GAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELL VLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV
Database link: P19320 -
Positive control
- Human tonsil and placenta tissues.
-
General notes
ab212938 is a carrier free version of ab216035. This format is designed for use in antibody labeling, including fluorochromes, metal isotypes, oligonucleotides, enzymes.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: PBS -
Carrier free
Yes -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
ab21635 was purified from Bioreactor Concentrate by Protein A/G. -
Clonality
Monoclonal -
Clone number
VCAM1/843 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab212938 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol. (Primary incubation for 30 minutes at RT).
|
Target
-
Function
Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with the beta-1 integrin VLA4 on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/VLA4 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation. -
Tissue specificity
Expressed on inflammed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflammed tissue. -
Sequence similarities
Contains 7 Ig-like C2-type (immunoglobulin-like) domains. -
Domain
Either the first or the fourth Ig-like C2-type domain is required for VLA4-dependent cell adhesion. -
Post-translational
modificationsSialoglycoprotein. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 7412 Human
- GenBank: NP_001069.1 Human
- GenBank: NP_001186763.1 Human
- Omim: 192225 Human
- SwissProt: P19320 Human
- Unigene: 109225 Human
-
Alternative names
- CD106 antibody
- CD106 Antigen antibody
- INCAM 100 antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab212938 has not yet been referenced specifically in any publications.