Overview

  • Product name

  • Description

    Rabbit polyclonal to VCP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Synthetic peptide corresponding to Human VCP aa 351-541.
    Sequence:

    NSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVA NETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMD DFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHP DKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFIS


    Database link: P55072

  • Positive control

    • WB: HEK-293T, BT-474, SW480, A549 and 22Rv1 cell extract.; Mouse brain, eye, heart and gastrocnemius muscle extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab238522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 89 kDa.

Target

  • Function

    Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope (By similarity). Regulates E3 ubiquitin-protein ligase activity of RNF19A.
  • Involvement in disease

    Defects in VCP are the cause of inclusion body myopathy with early-onset Paget disease and frontotemporal dementia (IBMPFD) [MIM:167320]; also known as muscular dystrophy, limb-girdle, with Paget disease of bone or pagetoid amyotrophic lateral sclerosis or pagetoid neuroskeletal syndrome or lower motor neuron degeneration with Paget-like bone disease. IBMPFD features adult-onset proximal and distal muscle weakness (clinically resembling limb girdle muscular dystrophy), early-onset Paget disease of bone in most cases and premature frontotemporal dementia.
  • Sequence similarities

    Belongs to the AAA ATPase family.
  • Post-translational
    modifications

    Phosphorylated by tyrosine kinases in response to T-cell antigen receptor activation (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
    ISGylated.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus. Present in the neuronal hyaline inclusion bodies specifically found in motor neurons from amyotrophic lateral sclerosis patients. Present in the Lewy bodies specifically found in neurons from Parkinson disease patients.
  • Information by UniProt
  • Database links

  • Alternative names

    • 15S Mg(2+) ATPase p97 subunit antibody
    • 15S Mg(2+)-ATPase p97 subunit antibody
    • ALS14 antibody
    • ATPase p97 antibody
    • CDC48 antibody
    • IBMPFD antibody
    • MGC131997 antibody
    • MGC148092 antibody
    • MGC8560 antibody
    • p97 antibody
    • TER ATPase antibody
    • TERA antibody
    • TERA_HUMAN antibody
    • Transitional endoplasmic reticulum ATPase antibody
    • Valosin containing protein antibody
    • Valosin-containing protein antibody
    • VCP antibody
    • Yeast Cdc48p homolog antibody
    see all

Images

  • All lanes : Anti-VCP antibody (ab238522) at 1/300 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell extracts
    Lane 2 : BT-474 (Human ductal breast epithelial tumor cell line) cell extracts
    Lane 3 : SW480 (Human colorectal adenocarcinoma cell line) cell extracts
    Lane 4 : A549 (Human lung carcinoma cell line) cell extracts
    Lane 5 : 22Rv1 (Human prostate carcinoma cell line) cell extracts
    Lane 6 : Mouse brain extract
    Lane 7 : Mouse eye extract
    Lane 8 : Mouse heart extract
    Lane 9 : Mouse gastrocnemius muscle extract

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 89 kDa


    Exposure time: 5 seconds


    Blocking buffer: 3% non-fat dry milk in TBST.

References

ab238522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up