Overview

  • Product name

    Anti-VDAC1/Porin antibody [N152B/23]
    See all VDAC1/Porin primary antibodies
  • Description

    Mouse monoclonal [N152B/23] to VDAC1/Porin
  • Host species

    Mouse
  • Specificity

    ab186321 does not cross-react with VDAC2 or VDAC3 (based on KO validation results).
  • Tested applications

    Suitable for: IHC-P, WB, IHC-Fr, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human VDAC1/Porin aa 1-283.
    Sequence:

    MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTE TTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD SSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWL AGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNK KLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQT LKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA


    Database link: P21796

  • Positive control

    • WB: Rat brain membrane lysate. ICC/IF: SK-N-BE cells.
  • General notes

    The clone number has been updated from S152B-23 to N152B/23, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab186321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB 1/1000. Detects a band of approximately 30 kDa (predicted molecular weight: 31 kDa).
IHC-Fr Use at an assay dependent concentration.
ICC/IF 1/100.

Target

  • Function

    Forms a channel through the mitochondrial outer membrane and also the plasma membrane. The channel at the outer mitochondrial membrane allows diffusion of small hydrophilic molecules; in the plasma membrane it is involved in cell volume regulation and apoptosis. It adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.
  • Tissue specificity

    Heart, liver and skeletal muscle.
  • Sequence similarities

    Belongs to the eukaryotic mitochondrial porin family.
  • Domain

    Consists mainly of a membrane-spanning beta-barrel formed by 19 beta-strands. The helical N-terminus folds back into the pore opening and plays a role in voltage-gated channel activity.
  • Cellular localization

    Mitochondrion outer membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • N2441 antibody
    • OMP2 antibody
    • POR1 antibody
    • hVDAC1 antibody
    • MGC111064 antibody
    • Mitochondrial Porin antibody
    • Outer mitochondrial membrane protein porin 1 antibody
    • Plasmalemmal porin antibody
    • Porin 31HL antibody
    • Porin 31HM antibody
    • VDAC antibody
    • VDAC-1 antibody
    • Vdac1 antibody
    • VDAC1_HUMAN antibody
    • Voltage dependent anion channel 1 antibody
    • Voltage dependent anion selective channel protein 1 antibody
    • Voltage-dependent anion-selective channel protein 1 antibody
    • YNL055C antibody
    • YNL2441C antibody
    see all

Images

  • 4% formaldehyde-fixed SK-N-BE cells stained for VDAC1/Porin (green) using ab186321 at 1/100 dilution in ICC/IF.

    Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1/100 for 60 minutes at room temperature. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1/1000; 1/5000 for 60 minutes room temperature, 5 minutes room temperature. (A) DAPI (blue) nuclear stain (B) Phalloidin Texas Red F-Actin stain (C) ab186321 (D) Composite.

  • Anti-VDAC1/Porin antibody [N152B/23] (ab186321) at 1/200 dilution + Rat brain memebrane lysate at 15 µg

    Secondary
    Goat Anti-Mouse IgG: HRP at 1/1000 dilution

    Predicted band size: 31 kDa

References

ab186321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Sample
Chinese hamster Cell lysate - whole cell (Chinese hamster)
Gel Running Conditions
Reduced Denaturing (15%)
Loading amount
25 µg
Specification
Chinese hamster
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 23°C

Herr Dr. Vladimir Milenkovic

Verified customer

Submitted Feb 22 2019

Application
Western blot
Sample
Rat Cell lysate - whole cell (Rat brain)
Gel Running Conditions
Reduced Denaturing (15%)
Loading amount
25 µg
Specification
Rat brain
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 23°C

Herr Dr. Vladimir Milenkovic

Verified customer

Submitted Jan 10 2019

Application
Western blot
Sample
Human Cell lysate - whole cell (HUH 7 hepatocarcinoma cell line)
Gel Running Conditions
Reduced Denaturing (15%)
Loading amount
25 µg
Specification
HUH 7 hepatocarcinoma cell line
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 23°C

Herr Dr. Vladimir Milenkovic

Verified customer

Submitted Jan 10 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up