Overview

  • Product name

    Anti-VDAC1/Porin antibody [N152B/23] (Biotin)
    See all VDAC1/Porin primary antibodies
  • Description

    Mouse monoclonal [N152B/23] to VDAC1/Porin (Biotin)
  • Host species

    Mouse
  • Conjugation

    Biotin
  • Specificity

    Does not cross-react with VDAC2 or VDAC3 (based on KO validation results).
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IF, IHC-Frmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Cow, Human, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human VDAC1/Porin aa 1-283.
    Sequence:

    MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTE TTKVTGSLET KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLT FDSSFSPNTGKKNAKIKTGYKR EHINLGCDMDFDIAGPSIRGALVLGY EGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL HTNVNDGTEFGGSI YQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS SL IGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA


    Database link: P21796

  • Positive control

    • Rat brain lysate.
  • General notes

    The clone number has been updated from S152B-23 to N152B/23, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab186262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Detects a band of approximately 30 kDa (predicted molecular weight: 31 kDa).
IHC-P Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.
IHC-Fr Use at an assay dependent concentration.

Target

  • Function

    Forms a channel through the mitochondrial outer membrane and also the plasma membrane. The channel at the outer mitochondrial membrane allows diffusion of small hydrophilic molecules; in the plasma membrane it is involved in cell volume regulation and apoptosis. It adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.
  • Tissue specificity

    Heart, liver and skeletal muscle.
  • Sequence similarities

    Belongs to the eukaryotic mitochondrial porin family.
  • Domain

    Consists mainly of a membrane-spanning beta-barrel formed by 19 beta-strands. The helical N-terminus folds back into the pore opening and plays a role in voltage-gated channel activity.
  • Cellular localization

    Mitochondrion outer membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • N2441 antibody
    • OMP2 antibody
    • POR1 antibody
    • hVDAC1 antibody
    • MGC111064 antibody
    • Mitochondrial Porin antibody
    • Outer mitochondrial membrane protein porin 1 antibody
    • Plasmalemmal porin antibody
    • Porin 31HL antibody
    • Porin 31HM antibody
    • VDAC antibody
    • VDAC-1 antibody
    • Vdac1 antibody
    • VDAC1_HUMAN antibody
    • Voltage dependent anion channel 1 antibody
    • Voltage dependent anion selective channel protein 1 antibody
    • Voltage-dependent anion-selective channel protein 1 antibody
    • YNL055C antibody
    • YNL2441C antibody
    see all

References

ab186262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up