Overview

  • Product name

  • Description

    Rabbit polyclonal to VE Cadherin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Cow, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human VE Cadherin aa 69-391. Expressed in E.coli. N-terminal tags.
    Sequence:

    GKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHL TAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGT SVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDRE KQARYEIVVEARDAQGLRGDSGTATVLVTLQDINDNFPFFTQTKYTFVVP EDTRVGTSVGSLFVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGI IKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVIINITDVDE PPIFQQPFYHFQLKENQKKPLIG


    Database link: P33151

  • Positive control

    • IHC-P: Human lung, skin cancer, breast cancer, kidney, prostate and liver tissues. WB: Recombinant human VE cadherin protein; Cow kidney, brain and spleen lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab232880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions. It associates with alpha-catenin forming a link to the cytoskeleton.
  • Tissue specificity

    Endothelial tissues and brain.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues by KDR/VEGFR-2. Dephosphorylated by PTPRB.
  • Cellular localization

    Cell junction. Cell membrane. Found at cell-cell boundaries and probably at cell-matrix boundaries.
  • Information by UniProt
  • Database links

  • Alternative names

    • 7B 4 antibody
    • 7B4 antibody
    • 7B4 antigen antibody
    • CADH5_HUMAN antibody
    • Cadherin 5 antibody
    • Cadherin 5 type 2 antibody
    • Cadherin 5, type 2 (vascular endothelium) antibody
    • Cadherin 5, type 2, VE cadherin (vascular epithelium) antibody
    • cadherin, vascular endothelial antibody
    • cadherin, vascular endothelial, 1 antibody
    • Cadherin-5 antibody
    • Cadherin5 antibody
    • CD 144 antibody
    • CD144 antibody
    • CD144 antigen antibody
    • CDH 5 antibody
    • CDH5 antibody
    • CDH5 protein antibody
    • Endothelial specific cadherin antibody
    • FLJ17376 antibody
    • OTTHUMP00000174777 antibody
    • Vascular endothelial cadherin antibody
    • Vascular epithelium cadherin antibody
    • VE Cad antibody
    • VE-cadherin antibody
    • VEC antibody
    see all

Images

  • All lanes : Anti-VE Cadherin antibody (ab232880) at 2 µg/ml

    Lane 1 : Cow kidney tissue lysate
    Lane 2 : Cow brain tissue lysate
    Lane 3 : Cow spleen tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human kidney tissue stained for VE Cadherin using ab232880 at 10 μg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal used at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for VE Cadherin using ab232880 at 10 μg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal used at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for VE Cadherin using ab232880 at 10 μg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal used at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human lung tissue stained for VE Cadherin using ab232880 at 10 μg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal used at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for VE Cadherin using ab232880 at 10 μg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal used at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for VE Cadherin using ab232880 at 10 μg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal used at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for VE Cadherin using ab232880 at 10 μg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal used at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for VE Cadherin using ab232880 at 10 μg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal used at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for VE Cadherin using ab232880 at 10 μg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal used at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human lung tissue stained for VE Cadherin using ab232880 at 10 μg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal used at 2 µg/ml. DAB staining.

  • Anti-VE Cadherin antibody (ab232880) at 2 µg/ml + Recombinant human VE cadherin protein

References

ab232880 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up