Overview

  • Product name

    Anti-VEGF Receptor 1 + VEGF Receptor 2 antibody
  • Description

    Rabbit polyclonal to VEGF Receptor 1 + VEGF Receptor 2
  • Host species

    Rabbit
  • Specificity

    This antibody is specific for VEGFR 1 with significant cross-reactivity with the VEGFR 2 protein.
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide corresponding to Mouse VEGF Receptor 1 + VEGF Receptor 2 aa 800-900.
    Sequence:

    PDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK VVQASAFG IKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGAC TK

  • Positive control

    • HUVEC lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab36844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/2000. Predicted molecular weight: 150 kDa.
ICC/IF 1/500.
IHC-P 1/250 - 1/500.

Target

  • Relevance

    Receptors for VEGF, VEGFB and PGF have a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. VEGF and its high-affinity binding receptors, the tyrosine kinases FLK1 and FLT1, are thought to be important for the development of embryonic vasculature. It has been shown that an alternately spliced form of FLT1 produces a soluble protein, termed sFLT1, which binds vascular endothelial growth factor with high affinity, playing an inhibitory role in angiogenesis.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • FLK1 antibody
    • FLT1 antibody
    • KDR antibody
    • Kinase insert domain receptor antibody
    • Vascular endothelial growth factor receptor 1 antibody
    • Vascular endothelial growth factor receptor 2 antibody
    • Vascular permeability factor receptor antibody
    • VEGFR 2 antibody
    • VEGFR antibody
    • VEGFR-1 antibody
    • VEGFR1 antibody
    see all

Images

  • IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human breast carcinoma tissue section using 1:500 dilution of ab36844. The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes.

  • IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human breast carcinoma tissue section using 1:500 dilution of ab36844. The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes.

References

This product has been referenced in:

  • Yu R  et al. Therapeutic effects of lenvatinib in combination with rAd-p53 for the treatment of non-small cell lung cancer. Oncol Lett 16:6573-6581 (2018). Read more (PubMed: 30405797) »
  • Song W  et al. Quercetin inhibits angiogenesis-mediated human retinoblastoma growth by targeting vascular endothelial growth factor receptor. Oncol Lett 14:3343-3348 (2017). Read more (PubMed: 28927086) »
See all 4 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab36844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up