Anti-VEGF Receptor 1 antibody [EWF] (ab11934)
Key features and details
- Mouse monoclonal [EWF] to VEGF Receptor 1
- Suitable for: WB
- Reacts with: Mouse, Human
- Isotype: IgG1
Overview
-
Product name
Anti-VEGF Receptor 1 antibody [EWF]
See all VEGF Receptor 1 primary antibodies -
Description
Mouse monoclonal [EWF] to VEGF Receptor 1 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human VEGF Receptor 1 aa 1-687.
Sequence:MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLH LQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN HTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTE GRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYK EIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVL NCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGK RSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDA GNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGN RIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISF YITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQK KEITIRGEHCNKKAVFSRISKFKSTRNDCTTQSNVKH
Database link: P17948-2 -
Positive control
- WB: Recombinant human soluble VEGF Receptor 1; Conditioned media from insect cells expressing recombinant human soluble VEGF Receptor 1; Supernantant from Adenovirus Infected A549 cells expressing mouse VEGF Receptor 1.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Lyophilised. Reconstitute in sterile water to a concentration of 0.1-1.0 mg/ml. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Clone number
EWF -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab11934 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 - 10 µg/ml. Predicted molecular weight: 150 kDa. |
Target
-
Function
Receptor for VEGF, VEGFB and PGF. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. Isoform SFlt1 may have an inhibitory role in angiogenesis. -
Tissue specificity
Mostly in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform sFlt1 is strongly expressed in placenta. -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 protein kinase domain. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 2321 Human
- Entrez Gene: 14254 Mouse
- Omim: 165070 Human
- SwissProt: P17948 Human
- SwissProt: P35969 Mouse
- Unigene: 594454 Human
- Unigene: 389712 Mouse
-
Alternative names
- EC 2.7.10.1 antibody
- FLT 1 antibody
- FLT antibody
see all
Images
-
Lane 1 : Anti-VEGF Receptor 1 antibody [EWF] (ab11934) at 10 mg/ml
Lane 2 : Anti-VEGF Receptor 1 antibody [EWF] (ab11934) at 10 µg/ml
Lane 1 : Recombinant human soluble VEGF Receptor 1
Lane 2 : Supernantant from Adenovirus Infected A549 cells expressing mouse VEGF Receptor 1
Predicted band size: 150 kDa -
All lanes : Anti-VEGF Receptor 1 antibody [EWF] (ab11934) at 10 µg/ml
All lanes : Conditioned media from insect cells expressing recombinant human
soluble VEGF Receptor 1
Predicted band size: 150 kDa -
All lanes : Anti-VEGF Receptor 1 antibody [EWF] (ab11934) at 10 µg/ml
All lanes : Conditioned media from insect cells expressing recombinant human
soluble VEGF Receptor 1
Predicted band size: 150 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab11934 has been referenced in 1 publication.
- Farzaneh Behelgardi M et al. A peptide mimicking the binding sites of VEGF-A and VEGF-B inhibits VEGFR-1/-2 driven angiogenesis, tumor growth and metastasis. Sci Rep 8:17924 (2018). PubMed: 30560942