For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    vegf-receptor-1-antibody-ewf-ab11934.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Growth Factors VEGF VEGF Receptors
Share by email

Anti-VEGF Receptor 1 antibody [EWF] (ab11934)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-VEGF Receptor 1 antibody [EWF] (ab11934)
  • Western blot - Anti-VEGF Receptor 1 antibody [EWF] (ab11934)
  • Western blot - Anti-VEGF Receptor 1 antibody [EWF] (ab11934)

Key features and details

  • Mouse monoclonal [EWF] to VEGF Receptor 1
  • Suitable for: WB
  • Reacts with: Mouse, Human
  • Isotype: IgG1

You may also be interested in

Primary
Product image
Anti-VEGF Receptor 1 antibody [Y103] - Low endotoxin, Azide free (ab184784)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Primary
Product image
Anti-VEGF Receptor 1 antibody [Y103] (ab32152)

View more associated products

Overview

  • Product name

    Anti-VEGF Receptor 1 antibody [EWF]
    See all VEGF Receptor 1 primary antibodies
  • Description

    Mouse monoclonal [EWF] to VEGF Receptor 1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human VEGF Receptor 1 aa 1-687.
    Sequence:

    MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLH LQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN HTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTE GRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYK EIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVL NCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGK RSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDA GNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQ ILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESFILDADSNMGN RIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISF YITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQK KEITIRGEHCNKKAVFSRISKFKSTRNDCTTQSNVKH


    Database link: P17948-2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Recombinant human soluble VEGF Receptor 1; Conditioned media from insect cells expressing recombinant human soluble VEGF Receptor 1; Supernantant from Adenovirus Infected A549 cells expressing mouse VEGF Receptor 1.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Lyophilized:Lyophilised. Reconstitute in sterile water to a concentration of 0.1-1.0 mg/ml.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    EWF
  • Isotype

    IgG1
  • Research areas

    • Cardiovascular
    • Angiogenesis
    • Growth Factors
    • VEGF
    • VEGF Receptors
    • Signal Transduction
    • Protein Phosphorylation
    • Tyrosine Kinases
    • Other
    • Signal Transduction
    • Growth Factors/Hormones
    • VEGF
    • Cancer
    • Growth factors
    • VEGF
    • Cancer
    • Invasion/microenvironment
    • Angiogenesis
    • Angiogenic growth factors
    • Cancer
    • Oncoproteins/suppressors
    • Oncoproteins
    • Growth factors
    • Cardiovascular
    • Vasculature
    • Endothelium
    • Cancer
    • Cancer Metabolism
    • Response to hypoxia
    • Metabolism
    • Pathways and Processes
    • Metabolism processes
    • Hypoxia
    • Cardiovascular
    • Angiogenesis
    • Endothelial Cell Markers

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Recombinant Protein

    • Recombinant human VEGF Receptor 1 protein (ab54346)

Applications

Our Abpromise guarantee covers the use of ab11934 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 10 µg/ml. Predicted molecular weight: 150 kDa.

Target

  • Function

    Receptor for VEGF, VEGFB and PGF. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. Isoform SFlt1 may have an inhibitory role in angiogenesis.
  • Tissue specificity

    Mostly in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform sFlt1 is strongly expressed in placenta.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Target information above from: UniProt accession P17948 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 2321 Human
    • Entrez Gene: 14254 Mouse
    • Omim: 165070 Human
    • SwissProt: P17948 Human
    • SwissProt: P35969 Mouse
    • Unigene: 594454 Human
    • Unigene: 389712 Mouse
    • Alternative names

      • EC 2.7.10.1 antibody
      • FLT 1 antibody
      • FLT antibody
      • Flt-1 antibody
      • FLT1 antibody
      • Fms like tyrosine kinase 1 antibody
      • Fms related tyrosine kinase 1 antibody
      • Fms related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) antibody
      • Fms related tyrosine kinase 1 vascular endothelial growth factor/vascular permeability factor receptor antibody
      • Fms-like tyrosine kinase 1 antibody
      • FRT antibody
      • Soluble VEGF receptor 1 14 antibody
      • Soluble VEGFR1 variant 2 antibody
      • Soluble VEGFR1 variant 21 antibody
      • Tyrosine protein kinase FRT antibody
      • Tyrosine protein kinase receptor FLT antibody
      • Tyrosine-protein kinase FRT antibody
      • Tyrosine-protein kinase receptor FLT antibody
      • Vascular endothelial growth factor receptor 1 antibody
      • Vascular endothelial growth factor vascular permeability factor receptor antibody
      • Vascular permeability factor receptor 1 antibody
      • Vascular permeability factor receptor antibody
      • VEGFR 1 antibody
      • VEGFR-1 antibody
      • VEGFR1 antibody
      • VGFR1_HUMAN antibody
      see all

    Images

    • Western blot - Anti-VEGF Receptor 1 antibody [EWF] (ab11934)
      Western blot - Anti-VEGF Receptor 1 antibody [EWF] (ab11934)
      Lane 1 : Anti-VEGF Receptor 1 antibody [EWF] (ab11934) at 10 mg/ml
      Lane 2 : Anti-VEGF Receptor 1 antibody [EWF] (ab11934) at 10 µg/ml

      Lane 1 : Recombinant human soluble VEGF Receptor 1
      Lane 2 : Supernantant from Adenovirus Infected A549 cells expressing mouse VEGF Receptor 1

      Predicted band size: 150 kDa

    • Western blot - Anti-VEGF Receptor 1 antibody [EWF] (ab11934)
      Western blot - Anti-VEGF Receptor 1 antibody [EWF] (ab11934)
      All lanes : Anti-VEGF Receptor 1 antibody [EWF] (ab11934) at 10 µg/ml

      All lanes : Conditioned media from insect cells expressing recombinant human
      soluble VEGF Receptor 1

      Predicted band size: 150 kDa

    • Western blot - Anti-VEGF Receptor 1 antibody [EWF] (ab11934)
      Western blot - Anti-VEGF Receptor 1 antibody [EWF] (ab11934)
      All lanes : Anti-VEGF Receptor 1 antibody [EWF] (ab11934) at 10 µg/ml

      All lanes : Conditioned media from insect cells expressing recombinant human
      soluble VEGF Receptor 1

      Predicted band size: 150 kDa

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab11934? Please let us know so that we can cite the reference in this datasheet.

    ab11934 has been referenced in 1 publication.

    • Farzaneh Behelgardi M  et al. A peptide mimicking the binding sites of VEGF-A and VEGF-B inhibits VEGFR-1/-2 driven angiogenesis, tumor growth and metastasis. Sci Rep 8:17924 (2018). PubMed: 30560942

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab11934.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.