Overview

  • Product name

    Anti-VEGF Receptor 1 antibody [EWI]
    See all VEGF Receptor 1 primary antibodies
  • Description

    Mouse monoclonal [EWI] to VEGF Receptor 1
  • Host species

    Mouse
  • Specificity

    This antibody can detect the native form of VEGF Receptor 1.
  • Tested applications

    Suitable for: Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human VEGF Receptor 1 aa 27-562. Soluble form.
    Sequence:

    SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPA TEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNV KPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHS EARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVAD SRISGIYICIASNKVGTVGRNISFYITDVPNGFHVN


    Database link: P17948-1

  • Positive control

    • WB: Recombinant human VEGF Receptor 1; Conditioned supernatant of insect cells expressing VEGF Receptor 1. Recombinant human soluble VEGFR 1 (sFlt-1 (D1-D7)-hFc), (sFlt-1 (native)) and (sFlt-1 (D1-D3)) proteins. Flow Cyt: Porcine aortic endothelial cells (PAE/Flt1) expressing human VEGF Receptor 1.

Properties

Applications

Our Abpromise guarantee covers the use of ab238632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use a concentration of 2 - 10 µg/ml.
WB Use a concentration of 1 - 10 µg/ml. Predicted molecular weight: 151 kDa.

Target

  • Function

    Receptor for VEGF, VEGFB and PGF. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. Isoform SFlt1 may have an inhibitory role in angiogenesis.
  • Tissue specificity

    Mostly in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform sFlt1 is strongly expressed in placenta.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.7.10.1 antibody
    • FLT 1 antibody
    • FLT antibody
    • Flt-1 antibody
    • FLT1 antibody
    • Fms like tyrosine kinase 1 antibody
    • Fms related tyrosine kinase 1 antibody
    • Fms related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) antibody
    • Fms related tyrosine kinase 1 vascular endothelial growth factor/vascular permeability factor receptor antibody
    • Fms-like tyrosine kinase 1 antibody
    • FRT antibody
    • Soluble VEGF receptor 1 14 antibody
    • Soluble VEGFR1 variant 2 antibody
    • Soluble VEGFR1 variant 21 antibody
    • Tyrosine protein kinase FRT antibody
    • Tyrosine protein kinase receptor FLT antibody
    • Tyrosine-protein kinase FRT antibody
    • Tyrosine-protein kinase receptor FLT antibody
    • Vascular endothelial growth factor receptor 1 antibody
    • Vascular endothelial growth factor vascular permeability factor receptor antibody
    • Vascular permeability factor receptor 1 antibody
    • Vascular permeability factor receptor antibody
    • VEGFR 1 antibody
    • VEGFR-1 antibody
    • VEGFR1 antibody
    • VGFR1_HUMAN antibody
    see all

Images

  • All lanes : Anti-VEGF Receptor 1 antibody [EWI] (ab238632) at 10 µg/ml

    Lane 1 : Recombinant human soluble VEGF Receptor 1 derived from insect cells
    Lane 2 : Supernatant from Adenoviris infected A549 cells expressing mouse VEGF Receptor 1

    Predicted band size: 151 kDa

  • Flow cytometric analysis of porcine aortic endothelial cells expressing human VEGF Receptor 1 using ab238632 at 10 μg/ml.

     

  • All lanes : Anti-VEGF Receptor 1 antibody [EWI] (ab238632) at 10 µg/ml

    Lane 1 : Recombinant human soluble VEGFR 1 (sFlt-1 (D1-D7)-hFc)
    Lane 2 : Recombinant human soluble VEGFR 1 (sFlt-1 (native))
    Lane 3 : Recombinant human soluble VEGFR 1 (sFlt-1 (D1-D3))

    Predicted band size: 151 kDa

  • All lanes : Anti-VEGF Receptor 1 antibody [EWI] (ab238632) at 10 µg/ml

    All lanes : Recombinant human endogenous soluble VEGF Receptor 1 with sf9 derived conditioned supernatant (Insect cells).

    Predicted band size: 151 kDa



    10% SDS-PAGE

  • All lanes : Anti-VEGF Receptor 1 antibody [EWI] (ab238632) at 10 µg/ml

    Lane 1 : Soluble recombinant VEGF Receptor 1 at 2 µg
    Lane 2 : Endogenous soluble recombinant VEGF Receptor 1 at 1 µg
    Lane 3 : Soluble recombinant VEGF Receptor 2 at 2 µg

    Predicted band size: 151 kDa

References

ab238632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up