Overview

  • Product name

    Anti-VEGF Receptor 2 antibody [#4 (20I6)]
    See all VEGF Receptor 2 primary antibodies
  • Description

    Mouse monoclonal [#4 (20I6)] to VEGF Receptor 2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human VEGF Receptor 2 aa 20-678.
    Sequence:

    ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSG SEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQ DYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKR FVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVV GYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQH KKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNS TFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGI PLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYV PPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANE PSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVI QAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSL WCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSN STNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLGRETILD HCAEAVGMP


    Database link: P35968-2

  • Positive control

    • WB: Recombinant human VEGF Receptor 2 protein. ICC/IF: HUVEC cells. Flow Cyt: HDLEC cells.
  • General notes

    The lyophilized antibody is stable at room temperature for up to 1 month. The reconstituted antibody is stable for at least two weeks at 2-8°C. Frozen aliquots are stable for at least 6 months when stored at -20°C.

Properties

Applications

Our Abpromise guarantee covers the use of ab39378 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 - 5 µg/ml. Predicted molecular weight: 110 kDa.
ICC/IF Use a concentration of 2 - 10 µg/ml.
Flow Cyt Use a concentration of 2 - 5 µg/ml.

Target

  • Function

    Receptor for VEGF or VEGFC. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.
  • Involvement in disease

    Defects in KDR are associated with susceptibility to hemangioma capillary infantile (HCI) [MIM:602089]. HCI are benign, highly proliferative lesions involving aberrant localized growth of capillary endothelium. They are the most common tumor of infancy, occurring in up to 10% of all births. Hemangiomas tend to appear shortly after birth and show rapid neonatal growth for up to 12 months characterized by endothelial hypercellularity and increased numbers of mast cells. This phase is followed by slow involution at a rate of about 10% per year and replacement by fibrofatty stroma.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated. Dephosphorylated by PTPRB. Dephosphorylated by PTPRJ at Tyr-951, Tyr-996, Tyr-1054, Tyr-1059, Tyr-1175 and Tyr-1214.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD309 antibody
    • CD309 antigen antibody
    • EC 2.7.10.1 antibody
    • Fetal liver kinase 1 antibody
    • FLK-1 antibody
    • FLK1 antibody
    • FLK1, mouse, homolog of antibody
    • Kdr antibody
    • Kinase insert domain receptor (a type III receptor tyrosine kinase) antibody
    • Kinase insert domain receptor antibody
    • KRD1 antibody
    • Ly73 antibody
    • Protein tyrosine kinase receptor FLK1 antibody
    • Protein-tyrosine kinase receptor flk-1 antibody
    • soluble VEGFR2 antibody
    • Tyrosine kinase growth factor receptor antibody
    • Vascular endothelial growth factor receptor 2 antibody
    • VEGFR 2 antibody
    • VEGFR antibody
    • VEGFR-2 antibody
    • VEGFR2 antibody
    • VGFR2_HUMAN antibody
    see all

Images

  • All lanes : Anti-VEGF Receptor 2 antibody [#4 (20I6)] (ab39378) at 5 µg/ml

    Lane 1 : Recombinant human VEGF Receptor 2 protein
    Lane 2 : Recombinant human VEGF Receptor 2 (aa 20-678) protein
    Lane 3 : Recombinant human VEGF Receptor 2 (aa 20-678) protein-Fc

    Predicted band size: 110 kDa



    10% SDS-PAGE gel under reducing conditions.

  • Flow cytometric analysis of HDLEC (primary human dermal lymphatic endothelial cells) labeling VEGF Receptor 2 using ab39378 at 5 μg/ml (red) compared to a negative control (unshaded).

  • HUVEC (human umbilical vein endothelial cell line) cells stained for VEGF Receptor 2 (green) using ab39378 at 7.5 μg/ml in ICC/IF. The nuclear counter stain is DAPI (blue).

    A Goat anti-Mouse Alexa Fluor®488 conjugate was used as secondary antibody at 1/600 dilution.

References

ab39378 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab39378.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up