For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Explore the power of knock-out cell lines for your research

  1. Link

    vegf-receptor-3-antibody-ab27278.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Growth Factors VEGF VEGF Receptors
Share by email

Anti-VEGF Receptor 3 antibody (ab27278)

  • Datasheet
  • SDS
Reviews (8)Q&A (6)References (41)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-VEGF Receptor 3 antibody (ab27278)
  • Immunocytochemistry/ Immunofluorescence - Anti-VEGF Receptor 3 antibody (ab27278)
  • Western blot - Anti-VEGF Receptor 3 antibody (ab27278)

Key features and details

  • Rabbit polyclonal to VEGF Receptor 3
  • Suitable for: ICC/IF, WB, IHC-P, IHC - Wholemount
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

Get better batch-to-batch reproducibility with a recombinant antibody

Product image
Anti-VEGF Receptor 3 antibody [EPR22293-14] (ab243232)
  • Research with confidence – consistent and reproducible results with every batch
  • Long-term and scalable supply – powered by recombinant technology for fast production
  • Success from the first experiment – confirmed specificity through extensive validation
  • Ethical standards compliant – production is animal-free

Overview

  • Product name

    Anti-VEGF Receptor 3 antibody
    See all VEGF Receptor 3 primary antibodies
  • Description

    Rabbit polyclonal to VEGF Receptor 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-P, IHC - Wholemountmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human VEGF Receptor 3 aa 1250-1350. The exact sequence is proprietary.
    Database link: P35916

  • Positive control

    • IHC-P: Human placenta tissue. ICC/IF: HeLa cells. WB: Hey cell lysate.
  • General notes

    This product is FOR RESEARCH USE ONLY. For commercial use, please contact partnerships@abcam.com.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.60
    Preservative: 0.1% Sodium azide
    Constituents: PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Angiogenesis
    • Growth Factors
    • VEGF
    • VEGF Receptors
    • Signal Transduction
    • Protein Phosphorylation
    • Tyrosine Kinases
    • Receptor Tyrosine Kinases
    • Signal Transduction
    • Growth Factors/Hormones
    • VEGF
    • Epigenetics and Nuclear Signaling
    • Cell cycle
    • Kinases/Phosphatases
    • Other
    • Cancer
    • Growth factors
    • VEGF
    • Cancer
    • Invasion/microenvironment
    • Angiogenesis
    • Angiogenic growth factors
    • Cancer
    • Oncoproteins/suppressors
    • Oncoproteins
    • Growth factor receptors
    • Cardiovascular
    • Angiogenesis
    • Endothelial Cell Markers
    • Neuroscience
    • Development

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab27278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF
Use a concentration of 1 µg/ml.
WB (1)
Use at an assay dependent concentration. Predicted molecular weight: 146 kDa.
IHC-P (5)
1/100. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
IHC - Wholemount (1)
Use at an assay dependent concentration.
Notes
ICC/IF
Use a concentration of 1 µg/ml.
WB
Use at an assay dependent concentration. Predicted molecular weight: 146 kDa.
IHC-P
1/100. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
IHC - Wholemount
Use at an assay dependent concentration.

Target

  • Function

    Receptor for VEGFC. Has a tyrosine-protein kinase activity.
  • Tissue specificity

    Placenta, lung, heart, and kidney, does not seem to be expressed in pancreas and brain.
  • Involvement in disease

    Defects in FLT4 are the cause of lymphedema hereditary type 1A (LMPH1A) [MIM:153100]; also known as Nonne-Milroy lymphedema or Milroy disease. Hereditary lymphedema is a chronic disabling condition which results in swelling of the extremities due to altered lymphatic flow. Patients with lymphedema suffer from recurrent local infections and physical impairment.
    Note=Defects in FLT4 are found in juvenile hemangioma. Juvenile hemangiomas are the most common tumors of infancy, occurring as many as 10% of all births. These benign vascular lesions enlarge rapidly during the first year of life by hyperplasia of endothelial cells and attendant pericytes, and then spontaneously involute over a period of years, leaving loose fibrofatty tissue.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P35916 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 2324 Human
    • Entrez Gene: 14257 Mouse
    • Entrez Gene: 114110 Rat
    • Omim: 136352 Human
    • SwissProt: P35916 Human
    • SwissProt: P35917 Mouse
    • SwissProt: Q91ZT1 Rat
    • Unigene: 646917 Human
    • Unigene: 3291 Mouse
    • Unigene: 81043 Rat
    see all
  • Alternative names

    • EC 2.7.10.1 antibody
    • flt 4 antibody
    • FLT-4 antibody
    • FLT4 antibody
    • FLT41 antibody
    • Fms related tyrosine kinase 4 antibody
    • Fms-like tyrosine kinase 4 antibody
    • LMPH1A antibody
    • PCL antibody
    • Soluble VEGFR3 variant 1 antibody
    • Soluble VEGFR3 variant 2 antibody
    • Soluble VEGFR3 variant 3 antibody
    • Tyrosine protein kinase receptor FLT4 antibody
    • Tyrosine-protein kinase receptor FLT4 antibody
    • Vascular endothelial growth factor receptor 3 antibody
    • Vascular endothelial growth factor receptor 3 precursor antibody
    • VEGF R3 antibody
    • VEGFR 3 antibody
    • VEGFR-3 antibody
    • VEGFR3 antibody
    • VGFR3_HUMAN antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-VEGF Receptor 3 antibody (ab27278)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-VEGF Receptor 3 antibody (ab27278)
    Ab27278 at a dilution of 1/100, staining formalin fixed paraffin embedded Flt4 in human placenta by Immunohistochemistry.
  • Immunocytochemistry/ Immunofluorescence - Anti-VEGF Receptor 3 antibody (ab27278)
    Immunocytochemistry/ Immunofluorescence - Anti-VEGF Receptor 3 antibody (ab27278)
    ICC/IF image of ab27278 stained HeLa cells. The cells were 4% PFA fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab27278, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Western blot - Anti-VEGF Receptor 3 antibody (ab27278)
    Western blot - Anti-VEGF Receptor 3 antibody (ab27278)
    Anti-VEGF Receptor 3 antibody (ab27278) at 1/50 dilution
    Predicted band size: 146 kDa
    Observed band size: 170,200 kDa why is the actual band size different from the predicted?



    Hey cell lysate (50µg/lane) was used. The antibody was diluted at 1:50 for 2 hours at room tepterature Hey cell lysate (50µg/lane) was used. The antibody was diluted at 1:50 for 2 hours at room temperature. The protein is heavily glycosylated and this might explain the increase in MW above the predcted MW as well as the multiple bands.

Protocols

  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (41)

Publishing research using ab27278? Please let us know so that we can cite the reference in this datasheet.

ab27278 has been referenced in 41 publications.

  • Dai XW  et al. lncRNA-MIAT facilitates the differentiation of adipose-derived mesenchymal stem cells into lymphatic endothelial cells via the miR-495/Prox1 axis. Mol Med Rep 23:N/A (2021). PubMed: 33760182
  • Lin QY  et al. VEGF-C/VEGFR-3 axis protects against pressure-overload induced cardiac dysfunction through regulation of lymphangiogenesis. Clin Transl Med 11:e374 (2021). PubMed: 33783987
  • Li F  et al. Primary Preclinical and Clinical Evaluation of 68Ga-DOTA-TMVP1 as a Novel VEGFR-3 PET Imaging Radiotracer in Gynecological Cancer. Clin Cancer Res 26:1318-1326 (2020). PubMed: 31843751
  • Fontana F  et al. Antagonistic Activities of Vegfr3/Flt4 and Notch1b Fine-tune Mechanosensitive Signaling during Zebrafish Cardiac Valvulogenesis. Cell Rep 32:107883 (2020). PubMed: 32668254
  • Faruk EM  et al. Possible healing effects of Salvadora persica extract (MISWAK) and laser therapy in a rabbit model of a caustic-induced tongue ulcers: histological, immunohistochemical and biochemical study. J Mol Histol N/A:N/A (2020). PubMed: 32472334
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a question

1-6 of 6 Q&A

Question

The code expiration date should be xxx. Could you change it and send it again? Thank you!

Read More

Abcam community

Verified customer

Asked on Nov 29 2012

Answer

I am very pleased to hear you would like to accept our offer and test ab27278 in rat. This code will give you the VALUE of this product off an order before the expiration date. To redeem this offer, please submit an Abreview for rat. The code is inactive until included in your submitted Abreview so be sure to add it to the Additional Comments section. For more information on how to submit an Abreview, please visit the site: https://www.abcam.com/Abreviews. Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code. Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research. The terms and conditions applicable to this offer can be found here: https://www.abcam.com/AbTrial

Read More

Abcam Scientific Support

Answered on Nov 29 2012

Question

I just realized that this promotion expired. Can i get an extension? thank you

Read More

Abcam community

Verified customer

Asked on Aug 13 2012

Answer

Thank you for contacting us. I have created a new 100% Abreview Testing Discount Code for testing AB27278 in Porcine. This code will expire on xxxxxxx. xxxxx I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information. Use our products? Submit an Abreview. Earn rewards! https://www.abcam.com/abreviews

Read More

Abcam Scientific Support

Answered on Aug 13 2012

Question

Dear Sir or Madam,
I need anti-mouse VEGFR3 antibody (host – rabbit) for use in immunohistochemistry – frozen sections. Is your antibody (#27278) suitable for it?
Thank you in advance,

Read More

Abcam community

Verified customer

Asked on Aug 03 2012

Answer

Thank you very much for your interest in 27278.

To our knowledge, ab27278 has not been tested in IHC-Fr. Therefore, I can offer a discount off a future purchase if you buy ab27278 now, test it in IHC-Fr and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody.

If you are interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that you would like to proceed and test ab27278 in IHC-Fr. I will then send a discount code. This code must be issued before purchasing ab27278 so please wait for my reply before ordering.

2. Purchase ab27278 either by phone, fax, or online (https://www.abcam.com).

3. Test it in IHC-Fr.

4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue.
Please remember that submission of the Abreview is sufficient for the discount code to become active.

We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab27278 turns out to be unsuitable for IHC-Fr, you will still receive the discount on your next purchase after your Abreview has been submitted.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: https://www.abcam.com/collaborationdiscount.

Read More

Abcam Scientific Support

Answered on Aug 03 2012

Question

Yes, I will buy ab27278. I need to proceed with the purchase. Abcam will receive a PO tomorrow.

Read More

Abcam community

Verified customer

Asked on Apr 03 2012

Answer

I am very pleased to hear you would like to accept our offer and test ab27278 in porcine tissues. This code will give you 1 free PRIMARY ANTIBODY before the expiration date. To redeem this offer, please submit an Abreview for porcine tissues and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews. Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code. Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research. The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More

Abcam Scientific Support

Answered on Apr 03 2012

Question

What would you recommend for a VEGFR3 antibody for pig tissues? I know you have few more anti-VEGFR3 ? Also, I am eligible for a discount if i try it in pigs ? I will provide pictures of western . immuno, etc...

Read More

Abcam community

Verified customer

Asked on Apr 03 2012

Answer

I would be comfortable recommending this product for a number of reasons. The amino acid changes are minimal, the polarities remain the same and the hydropathy of the amino acids are similar. There should be minimal or no issues from this.

The only concern is whether the epitope recognized contains this 4aa area in which all these substitutions occur. However, as this is a polyclonal antibody it will have multiple epitope sites recogned. Therefore, as the remaining areas are intact, you should see good reactivity.


To our knowledge, this has not been tested in porcine. Therefore, I can offer a discount off a future purchase if you buy ab27278 now, test it in pig and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free PRIMARY ANTIBODY.

If you are interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that you would like to proceed and test ab27278in pig. I will then send a discount code. This code must be issued before purchasing ab27278 so please wait for my reply before ordering.

2. Purchase either by phone, fax, or online (www.abcam.com).

3. Test it in pig.

4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any PRIMARY ANTIBODY ordered and the discount code is valid for 4 months after issue.

We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab27278 turns out to be unsuitable for pig, you will still receive the discount on your next purchase after your Abreview has been submitted.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

Read More

Abcam Scientific Support

Answered on Apr 03 2012

Question

I want to buy the antibody ab27278 (VEGFR3). I have the pig sequence (below). Can you please check for homology with the epitope sequence used to make this antibody? PIG VEGFR3 (FLT4) LQAAGSLGWRLPVVLGPYSPGPASGYSMTPPTLNITEETHIIDSSDSLSISCRGQHPLEW AWPGAQDAPVMGEKDSEDTGIVRDCEGTDTRPYCKVLLLQEAHANDTGSYRCYYKYIKAR IEGTTAASTYVFVRDPEQPFINKPDTLLVNRKDSMWVPCRVSIPGLNITLRSQSSVLRPD GQEVVWDDRRGMRVPTPLLRDALYLQCETSWGGQAFLSNPFLVHITGNELYDIQLFPKKS LELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGRWVPERRSQQTHTELSSILTIHN VSQHDLGPYVCQANNGIQQFQESTEVIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLA AYPLPEFQWYKDRKALSGRHSPHALVLKEVTEASAGIYTLALWNSAAGLRRNISLELVVN VPPHIHEKEASSPSIYSRHSRQALTCTAYGVPPPLGIQWHWRPWTPCKTFTQRSLHRRQQ RDRMPQCRDWREVTTQDAINPIESLDTWTEFVEGKNKTVSKLVIQDANVSAMYKCVVFNK VGQDERLIYFYVTTIPDGFSIESEPSEEPLEGQTVRLSCRADNYTYEHLRWYRLNLSMLH DAHGNPLLLDCKNVHLFATPLAASLEEAAPGVRHATLSLTIPSVALEHEGDYVCEVQDRR SHDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLA EESGIDLTDSNQKLSIRRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVIL VGTGVIAVFFWVLLLLIFCNMRRPTHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWE FPRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKI LIHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRAKREAFNPYAEKTLEQRRR FRSMVESAKADRRRPGTSDRALLTKLLTGKGGAGRAPLVQEAEDLWLSPLTMEDLVCYSF QVARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLK WMAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKEGTRMRAPEL ATPAIRRIMLSCWAGEPKERPAFSDLVEILGDLLQAGSRQEEEDCLAPCDSQSSEEGSFL QASTTALHVAEADTDAEDSPPSLHRHSLAARYYNCVSFPGCLARGSQTQGPSRMKTFEEF PMTPTTYKASADNQTDSGMVLASEEFERLENRHRQEGKLSCKGPGRNADVTAVHPDPQGR WRRPDRGARGQVFYNSEYGELAGPQEEGDSTPSTHVPFFTDNSY

Read More

Abcam community

Verified customer

Asked on Apr 02 2012

Answer

Thank you for contacting us. This product has an 81% identity with pig VEGFR3. Of the three non-matched amino acids within the overlap, the variations are as follows: Q1286 - R1288 I1287 - L1289 S1289 - N1291 I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Abcam Scientific Support

Answered on Apr 02 2012

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.