Overview

  • Product name

  • Description

    Rabbit polyclonal to VEGFB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human VEGFB aa 80-130 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK D


    Database link: P49765

  • Positive control

    • Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
  • Tissue specificity

    Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas.
  • Sequence similarities

    Belongs to the PDGF/VEGF growth factor family.
  • Post-translational
    modifications

    VEGF-B186 is O-glycosylated.
  • Cellular localization

    Secreted. Secreted but remains associated to cells or to the extracellular matrix unless released by heparin.
  • Information by UniProt
  • Database links

  • Form

    There are 2 isoforms produced by alternative splicing.
  • Alternative names

    • Vascular endothelial growth factor B antibody
    • Vascular endothelial growth factor-related factor antibody
    • VEGF B antibody
    • VEGF related factor antibody
    • VEGF-B antibody
    • VEGF-related factor antibody
    • Vegfb antibody
    • VEGFB_HUMAN antibody
    • VEGFL antibody
    • VRF antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue, labeling VEGFB with ab217370 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217370 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up