Overview

  • Product name

    Anti-VEGFB antibody (Biotin)
    See all VEGFB primary antibodies
  • Description

    Rabbit polyclonal to VEGFB (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: Sandwich ELISA, WBmore details
  • Species reactivity


    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human VEGFB aa 22-207.
    Sequence:

    PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPS CVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQ CECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQG RGLELNPDTCRCRKLRR


    Database link: P49765

  • Positive control

    • WB: Recombinant human VEGFB protein.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab233505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA Use a concentration of 0.25 - 1 µg/ml. Can be paired for Sandwich ELISA with Rabbit polyclonal to VEGFB (ab233503).
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 21 kDa.

Target

  • Function

    Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
  • Tissue specificity

    Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas.
  • Sequence similarities

    Belongs to the PDGF/VEGF growth factor family.
  • Post-translational
    modifications

    VEGF-B186 is O-glycosylated.
  • Cellular localization

    Secreted. Secreted but remains associated to cells or to the extracellular matrix unless released by heparin.
  • Information by UniProt
  • Database links

  • Form

    There are 2 isoforms produced by alternative splicing.
  • Alternative names

    • Vascular endothelial growth factor B antibody
    • Vascular endothelial growth factor-related factor antibody
    • VEGF B antibody
    • VEGF related factor antibody
    • VEGF-B antibody
    • VEGF-related factor antibody
    • Vegfb antibody
    • VEGFB_HUMAN antibody
    • VEGFL antibody
    • VRF antibody
    see all

Images

  • Lanes 1-10 : Anti-VEGFB antibody (Biotin) (ab233505) at 0.2 µg/ml
    Lane 11 : Anti-VEGFB antibody (Biotin) (ab233505) at 0.2 µg

    Lane 1 : Recombinant human VEGFB protein, 250 ng
    Lane 2 : Recombinant human VEGFB protein, 125 ng
    Lane 3 : Recombinant human VEGFB protein, 62.5 ng
    Lane 4 : Recombinant human VEGFB protein, 31.25 ng
    Lane 5 : Recombinant human VEGFB protein, 15.625 ng
    Lane 6 : Recombinant human VEGFB protein, 7.8 ng
    Lane 7 : Recombinant human VEGFB protein, 3.9 ng
    Lane 8 : Recombinant human VEGFB protein, 1.95 ng
    Lane 9 : Recombinant human VEGFB protein, 0.98 ng
    Lane 10 : Recombinant human VEGFB protein, 0.49 ng
    Lane 11 : Recombinant human VEGFB protein, 0.24 ng

    Predicted band size: 21 kDa



    Reduced.

  • All lanes : Anti-VEGFB antibody (Biotin) (ab233505) at 0.2 µg/ml

    Lane 1 : Recombinant human VEGFB protein, 250 ng
    Lane 2 : Recombinant human VEGFB protein, 125 ng
    Lane 3 : Recombinant human VEGFB protein, 62.5 ng
    Lane 4 : Recombinant human VEGFB protein, 31.25 ng
    Lane 5 : Recombinant human VEGFB protein, 15.625 ng
    Lane 6 : Recombinant human VEGFB protein, 7.8 ng
    Lane 7 : Recombinant human VEGFB protein, 3.9 ng
    Lane 8 : Recombinant human VEGFB protein, 1.95 ng
    Lane 9 : Recombinant human VEGFB protein, 0.98 ng
    Lane 10 : Recombinant human VEGFB protein, 0.49 ng
    Lane 11 : Recombinant human VEGFB protein, 0.24 ng

    Predicted band size: 21 kDa



    Non-reduced.

  • ab233505, in conjunction with Anti-human VEGFB as a capture antibody, allows the detection of at least 2000-4000 pg/ml of Recombinant human VEGFB.

References

ab233505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up