Overview

  • Product name
    Anti-VEGFC antibody [197CT7.3.4]
    See all VEGFC primary antibodies
  • Description
    Mouse monoclonal [197CT7.3.4] to VEGFC
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human VEGFC aa 1-290 (N terminal). (NP_005420.1)
    Sequence:

    MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATA YASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLN SRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNT FFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVT ISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWN NHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEET


    Database link: P49767

  • Positive control
    • Human Small Intestine tissue, 293, CEM, Mouse heart and rat heart lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab191274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100. Predicted molecular weight: 46 kDa.
IHC-P 1/50.

Target

  • Function
    Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.
  • Tissue specificity
    Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte.
  • Sequence similarities
    Belongs to the PDGF/VEGF growth factor family.
  • Post-translational
    modifications
    Undergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3, but only the fully processed form could activate VEGFR-2. VEGF-C first form an antiparallel homodimer linked by disulfide bonds. Before secretion, a cleavage occurs between Arg-227 and Ser-228 producing an heterotetramer. The next extracellular step of the processing removes the N-terminal propeptide. Finally the mature VEGF-C is composed mostly of two VEGF homology domains (VHDs) bound by non-covalent interactions.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Flt 4L antibody
    • Flt4 ligand antibody
    • FLT4 ligand DHM antibody
    • Flt4-L antibody
    • Flt4L antibody
    • Vascular endothelial growth factor C antibody
    • Vascular endothelial growth factor related protein antibody
    • Vascular endothelial growth factor-related protein antibody
    • VEGF C antibody
    • VEGF-C antibody
    • Vegfc antibody
    • VEGFC_HUMAN antibody
    • VRP antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human small intestine tissue labeling VEGFC with ab191274 at 1/50 dilution.

  • All lanes : Anti-VEGFC antibody [197CT7.3.4] (ab191274) at 1/100 dilution

    Lane 1 : 293 cell lysate
    Lane 2 : CEM cell lysate
    Lane 3 : Mouse heart cell lysate
    Lane 4 : Rat heart lysate

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 46 kDa

References

This product has been referenced in:
  • Zhao T  et al. The siRNA silencing of DcR3 expression induces Fas ligand-mediated apoptosis in HepG2 cells. Exp Ther Med 15:4370-4378 (2018). Read more (PubMed: 29725377) »
  • Tao P  et al. miR-144 inhibits growth and metastasis of cervical cancer cells by targeting VEGFA and VEGFC. Exp Ther Med 15:562-568 (2018). Read more (PubMed: 29387205) »
See all 4 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191274.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up