Anti-VEGFC antibody (ab9546)
Key features and details
- Rabbit polyclonal to VEGFC
- Suitable for: IHC-P, IHC-FoFr, WB, ELISA
- Reacts with: Mouse, Rat, Sheep, Human
- Isotype: IgG
Overview
-
Product name
Anti-VEGFC antibody
See all VEGFC primary antibodies -
Description
Rabbit polyclonal to VEGFC -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, IHC-FoFr, WB, ELISAmore details
Unsuitable for: IP -
Species reactivity
Reacts with: Mouse, Rat, Sheep, Human -
Immunogen
Recombinant fragment corresponding to Rat VEGFC aa 101-221. Produced from sera of rabbits pre-immunized with highly pure recombinant rat VEGF-C (Asp101-Ile221) derived from insect cells.
Sequence:DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH
Database link: P49767 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab9546 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
Use at an assay dependent concentration. PubMed: 21359148
|
|
IHC-FoFr |
Use at an assay dependent concentration. PubMed: 22206010
|
|
WB |
Use a concentration of 2 - 5 µg/ml.
|
|
ELISA |
Use a concentration of 1 - 5 µg/ml.
Allows the detection of 0.5-1.0 ng/well of recombinant rat VEGF-C. |
Notes |
---|
IHC-P
Use at an assay dependent concentration. PubMed: 21359148 |
IHC-FoFr
Use at an assay dependent concentration. PubMed: 22206010 |
WB
Use a concentration of 2 - 5 µg/ml. |
ELISA
Use a concentration of 1 - 5 µg/ml. Allows the detection of 0.5-1.0 ng/well of recombinant rat VEGF-C. |
Target
-
Function
Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. -
Tissue specificity
Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte. -
Sequence similarities
Belongs to the PDGF/VEGF growth factor family. -
Post-translational
modificationsUndergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3, but only the fully processed form could activate VEGFR-2. VEGF-C first form an antiparallel homodimer linked by disulfide bonds. Before secretion, a cleavage occurs between Arg-227 and Ser-228 producing an heterotetramer. The next extracellular step of the processing removes the N-terminal propeptide. Finally the mature VEGF-C is composed mostly of two VEGF homology domains (VHDs) bound by non-covalent interactions. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 7424 Human
- Entrez Gene: 22341 Mouse
- Entrez Gene: 114111 Rat
- Omim: 601528 Human
- SwissProt: P49767 Human
- SwissProt: Q6FH59 Human
- SwissProt: P97953 Mouse
- SwissProt: O35757 Rat
see all -
Alternative names
- Flt 4L antibody
- Flt4 ligand antibody
- FLT4 ligand DHM antibody
see all
Images
-
Western analysis of recombinant human and rat VEGF-C using a polyclonal rabbit anti-rat VEGF-C antibody.
-
Western blot with recombinant rat VEGF C fused to His-tag using the polyclonal anti VEGF C antibody ab9546. Bands are between 15kDa and 20kDa represents glycosylation forms.
-
Western blot with human and rat VEGF C and VEGF D using the polyclonal anti VEGF C antibody ab9546. Proteins were separated by 15% SDS-PAGE and blotted on to PVDF membranes as described. After transfer, the membrane was incubated for 1 h with ab9546 at 1 µg/ml in TBS containing 20% non-fat milk followed by incubation with a goat-anti-rabbit alkaline phosphatase-conjugated secondary antibody. Lane 1/250ng rat VEGF C; lane 2/250 ng human VEGF C; lane 3/250 ng rat VEGF D; lane4/250 ng human VEGF-D.
-
Anti-VEGFC antibody (ab9546) + Rat Recombinant VEGF-C insect cells
Western Blot was run on a 15% SDS-PAGE gel. Bands between 15kDa and 20kDa represent the different glycoslation forms. -
VEGF-C sandwich-ELISA using ab9546 as capture antibody and recombinant rat VEGF-C as standard. Biotinylated rabbit anti-rat VEGF-C was used for detection.
Datasheets and documents
-
SDS download
-
Datasheet download
References (32)
ab9546 has been referenced in 32 publications.
- Zhang H et al. NEAT1 promotes the malignant development of bladder cancer by regulating the miR-101/VEGF-C pathway in vitro and in vivo. BMC Urol 22:193 (2022). PubMed: 36434587
- Zhao Z et al. Lung cancer-associated transcript 1 facilitates tumorigenesis in laryngeal squamous cell carcinoma through the targeted inhibition of miR-493. Mol Med Rep 23:N/A (2021). PubMed: 33215214
- Liu Y et al. CCR10/CCL27 crosstalk regulates cell metastasis via PI3K-Akt signaling axis in non-small-cell lung cancer. Am J Transl Res 13:13135-13146 (2021). PubMed: 34956534
- Wang F et al. miR-210 enhances mesenchymal stem cell-modulated neural precursor cell migration. Mol Med Rep 21:2405-2414 (2020). PubMed: 32323777
- Kim IK et al. Mutant GTF2I induces cell transformation and metabolic alterations in thymic epithelial cells. Cell Death Differ 27:2263-2279 (2020). PubMed: 32034314