Anti-VEGF Receptor 1 + VEGF Receptor 2 antibody (ab36844)
Key features and details
- Rabbit polyclonal to VEGF Receptor 1 + VEGF Receptor 2
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-VEGF Receptor 1 + VEGF Receptor 2 antibody -
Description
Rabbit polyclonal to VEGF Receptor 1 + VEGF Receptor 2 -
Host species
Rabbit -
Specificity
This antibody is specific for VEGFR 1 with significant cross-reactivity with the VEGFR 2 protein. -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide corresponding to Mouse VEGF Receptor 1 + VEGF Receptor 2 aa 800-900.
Sequence:PDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK VVQASAFG IKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGAC TK
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4
Preservative: 0.05% Sodium azide -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
ab36844 is an affinity purified IgG. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab36844 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use at an assay dependent concentration.
|
|
ICC/IF |
Use at an assay dependent concentration.
|
|
IHC-P |
1/250 - 1/500.
|
Notes |
---|
WB
Use at an assay dependent concentration. |
ICC/IF
Use at an assay dependent concentration. |
IHC-P
1/250 - 1/500. |
Target
-
Relevance
Receptors for VEGF, VEGFB and PGF have a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. VEGF and its high-affinity binding receptors, the tyrosine kinases FLK1 and FLT1, are thought to be important for the development of embryonic vasculature. It has been shown that an alternately spliced form of FLT1 produces a soluble protein, termed sFLT1, which binds vascular endothelial growth factor with high affinity, playing an inhibitory role in angiogenesis. -
Cellular localization
Cell Membrane -
Database links
- Entrez Gene: 2321 Human
- Entrez Gene: 3791 Human
- Entrez Gene: 14254 Mouse
- Entrez Gene: 16542 Mouse
- Omim: 165070 Human
- Omim: 191306 Human
- SwissProt: P17948 Human
- SwissProt: P35968 Human
see all -
Alternative names
- FLK1 antibody
- FLT1 antibody
- KDR antibody
see all
Images
-
IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human breast carcinoma tissue section using 1:500 dilution of ab36844. The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes.
-
IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human breast carcinoma tissue section using 1:500 dilution of ab36844. The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (9)
ab36844 has been referenced in 9 publications.
- Fan X et al. Sunitinib Reduced the Migration of Ectopic Endometrial Cells via p-VEGFR-PI3K-AKT-YBX1-Snail Signaling Pathway. Anal Cell Pathol (Amst) 2022:6042518 (2022). PubMed: 35837295
- Zhang D et al. Dexamethasone and lenvatinib inhibit migration and invasion of non-small cell lung cancer by regulating EKR/AKT and VEGF signal pathways. Exp Ther Med 19:762-770 (2020). PubMed: 31853327
- Li P et al. Anisodamine Suppressed the Growth of Hepatocellular Carcinoma Cells, Induced Apoptosis and Regulated the Levels of Inflammatory Factors by Inhibiting NLRP3 Inflammasome Activation. Drug Des Devel Ther 14:1609-1620 (2020). PubMed: 32425506
- Fan C et al. Myocardial protection by nanomaterials formulated with CHIR99021 and FGF1. JCI Insight 5:N/A (2020). PubMed: 32453715
- Yu R et al. Therapeutic effects of lenvatinib in combination with rAd-p53 for the treatment of non-small cell lung cancer. Oncol Lett 16:6573-6581 (2018). PubMed: 30405797
- Song W et al. Quercetin inhibits angiogenesis-mediated human retinoblastoma growth by targeting vascular endothelial growth factor receptor. Oncol Lett 14:3343-3348 (2017). PubMed: 28927086
- Li F et al. The angiogenic effect of dracorhodin perchlorate on human umbilical vein endothelial cells and its potential mechanism of action. Mol Med Rep 14:1667-72 (2016). PubMed: 27357516
- Nusrat O et al. The Role of Angiogenesis in the Persistence of Chemoresistance in Epithelial Ovarian Cancer. Reprod Sci 23:1484-1492 (2016). PubMed: 27122375
- Shi J et al. Xiaotan Sanjie decoction inhibits angiogenesis in gastric cancer through Interleukin-8-linked regulation of the vascular endothelial growth factor pathway. J Ethnopharmacol 189:230-7 (2016). PubMed: 27224240