Overview

  • Product name

  • Description

    Rabbit polyclonal to Versican
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human Versican aa 3360-3395 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    RTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESR


    Database link: P13611

  • Positive control

    • Rat and mouse brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab202906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

Target

  • Function

    May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
  • Tissue specificity

    Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissues except medulloblastomas.
  • Involvement in disease

    Defects in VCAN are the cause of Wagner syndrome type 1 (WGN1) [MIM:143200]. WGN is a dominantly inherited vitreoretinopathy characterized by an optically empty vitreous cavity with fibrillary condensations and a preretinal avascular membrane. Other optical features include progressive chorioretinal atrophy, perivascular sheating, subcapsular cataract and myopia. Systemic manifestations are absent in WGN.
  • Sequence similarities

    Belongs to the aggrecan/versican proteoglycan family.
    Contains 1 C-type lectin domain.
    Contains 2 EGF-like domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
    Contains 2 Link domains.
    Contains 1 Sushi (CCP/SCR) domain.
  • Developmental stage

    Disappears after the cartilage development.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Chondroitin sulfate proteoglycan 2 antibody
    • Chondroitin sulfate proteoglycan core protein 2 antibody
    • Chondroitin sulfate proteoglycan core protein, cartilage antibody
    • CSPG2 antibody
    • CSPG2_HUMAN antibody
    • ERVR antibody
    • GHAP antibody
    • Glial hyaluronate binding protein antibody
    • Glial hyaluronate-binding protein antibody
    • Large fibroblast proteoglycan antibody
    • PG-M antibody
    • PGM antibody
    • VCAN antibody
    • Versican antibody
    • Versican core protein antibody
    • Versican proteoglycan antibody
    • WGN 1 antibody
    • WGN antibody
    • WGN1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded mouse brain tissue sections labeling Versican with ab202906 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded rat brain tissue sections labeling Versican with ab202906 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab202906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up