Anti-Vgl4 antibody (ab243518)
Key features and details
- Rabbit polyclonal to Vgl4
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Vgl4 antibody
See all Vgl4 primary antibodies -
Description
Rabbit polyclonal to Vgl4 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Vgl4 aa 50-125.
Sequence:PISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRE RSRSPIERAVAPTMSLHGSHLYTSLP
Database link: Q14135 -
Positive control
- IHC-P: Human endometrium, fallopian tube and cervix uterine tissues. WB: Vgl4 over-expression HEK-293T lysate (Co-expressed with a C-terminal myc-DDK tag). ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab243518 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 31 kDa. | |
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Relevance
Vgl4, vestigial-like protein 4 is a member of the vestigial family of proteins. It interacts with mammalian Transcriptional Enhancer Factors (TEFs) and may be a specific coactivator. Vgl4 also counteracts alpha1-adrenergic activation of gene expression in cardiac myocytes. There are 2 isoforms produced by alternative splicing. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 9686 Human
- SwissProt: Q14135 Human
-
Alternative names
- Transcription cofactor vestigial like protein 4 antibody
- Vestigial like protein 4 antibody
- VGL 4 antibody
- VGLL4 antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Vgl4 antibody (ab243518)
Paraffin-embedded human endometrium tissue stained for Vgl4 using ab243518 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Vgl4 antibody (ab243518)Paraffin-embedded human fallopian tube tissue stained for Vgl4 using ab243518 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Vgl4 antibody (ab243518)Paraffin-embedded human cervix, uterine tissue stained for Vgl4 using ab243518 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Vgl4 antibody (ab243518)Paraffin-embedded human skeletal muscle tissue stained for Vgl4 using ab243518 at 1/50 dilution in immunohistochemical analysis. Negative control.
-
Western blot - Anti-Vgl4 antibody (ab243518)All lanes : Anti-Vgl4 antibody (ab243518) at 0.4 µg/ml
Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
Lane 2 : Vgl4 over-expression HEK-293T lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)
Predicted band size: 31 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-Vgl4 antibody (ab243518)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Vgl4 (green) using ab243518 at 4 µg/ml in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243518 has not yet been referenced specifically in any publications.
