Anti-Vgl4 antibody (ab243518)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Vgl4 antibody
See all Vgl4 primary antibodies -
Description
Rabbit polyclonal to Vgl4 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Vgl4 aa 50-125.
Sequence:PISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRE RSRSPIERAVAPTMSLHGSHLYTSLP
Database link: Q14135 -
Positive control
- IHC-P: Human endometrium, fallopian tube and cervix uterine tissues. WB: Vgl4 over-expression HEK-293T lysate (Co-expressed with a C-terminal myc-DDK tag). ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab243518 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 31 kDa. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Relevance
Vgl4, vestigial-like protein 4 is a member of the vestigial family of proteins. It interacts with mammalian Transcriptional Enhancer Factors (TEFs) and may be a specific coactivator. Vgl4 also counteracts alpha1-adrenergic activation of gene expression in cardiac myocytes. There are 2 isoforms produced by alternative splicing. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 9686 Human
- SwissProt: Q14135 Human
-
Alternative names
- Transcription cofactor vestigial like protein 4 antibody
- Vestigial like protein 4 antibody
- VGL 4 antibody
- VGLL4 antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Vgl4 antibody (ab243518)Paraffin-embedded human endometrium tissue stained for Vgl4 using ab243518 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Vgl4 antibody (ab243518)Paraffin-embedded human fallopian tube tissue stained for Vgl4 using ab243518 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Vgl4 antibody (ab243518)Paraffin-embedded human cervix, uterine tissue stained for Vgl4 using ab243518 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Vgl4 antibody (ab243518)Paraffin-embedded human skeletal muscle tissue stained for Vgl4 using ab243518 at 1/50 dilution in immunohistochemical analysis. Negative control.
-
Western blot - Anti-Vgl4 antibody (ab243518)All lanes : Anti-Vgl4 antibody (ab243518) at 0.4 µg/ml
Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
Lane 2 : Vgl4 over-expression HEK-293T lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)
Predicted band size: 31 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-Vgl4 antibody (ab243518)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Vgl4 (green) using ab243518 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab243518 has not yet been referenced specifically in any publications.
