Overview

  • Product name

    Anti-VGLUT2 antibody [CL2921]
    See all VGLUT2 primary antibodies
  • Description

    Mouse monoclonal [CL2921] to VGLUT2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human VGLUT2 aa 516-581.
    Sequence:

    CGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFV QGEVQDSHSYKDRVDY


    Database link: Q9P2U8

  • Epitope

    Binds to an epitope located within the peptide sequence EETGDITQNYINYGT as determined by overlapping synthetic peptides.
  • Positive control

    • Rat cerebellum, mouse thalamus, Human cerebellum, rat hippocampal formation, mouse cerebellum and Human cerebral cortex tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL2921
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab211869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate.
  • Tissue specificity

    Predominantly expressed in adult brain. Expressed in amygdala, caudate nucleus, cerebral cortex, frontal lobe, hippocampus, medulla, occipital lobe, putamen, spinal cord, substantia nigra, subthalamic nucleus, temporal lobe and thalamus.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Sodium/anion cotransporter family. VGLUT subfamily.
  • Developmental stage

    Expressed in fetal brain.
  • Cellular localization

    Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Membrane. Cell junction, synapse, synaptosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Differentiation associated BNPI antibody
    • Differentiation associated Na dependent inorganic phosphate cotransporter antibody
    • Differentiation associated Na(+) dependent inorganic phosphate cotransporter antibody
    • Differentiation-associated BNPI antibody
    • Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter antibody
    • DNPI antibody
    • SLC17A6 antibody
    • Sodium dependent inorganic phosphate cotransporter antibody
    • Solute carrier family 17 (Sodium dependent inorganic phosphate cotransporter) member 6 antibody
    • Solute carrier family 17 member 6 antibody
    • Vesicular glutamate transporter 2 antibody
    • Vesicular glutamate transporter type 2 antibody
    • VGLU2_HUMAN antibody
    • VGLUT 2 antibody
    • VGluT2 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling VGLUT2 with ab211869 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue labeling VGLUT2 with ab211869 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded rat hippocampal formation tissue labeling VGLUT2 with ab211869 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling VGLUT2 with ab211869 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded mouse thalamus tissue labeling VGLUT2 with ab211869 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue labeling VGLUT2 with ab211869 at 1/200 dilution.

References

ab211869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up