Overview

  • Product name

    Anti-VGLUT3 antibody [N34/34]
    See all VGLUT3 primary antibodies
  • Description

    Mouse monoclonal [N34/34] to VGLUT3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, IHC-Frmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Fusion protein (His-tag) corresponding to Rat VGLUT3 aa 546-588 (C terminal).
    Sequence:

    MSYGATTQNCEVQKTDRRQQRESAFEGEEPLSYQNEEDFSETS


    Database link: Q7TSF2

  • Positive control

    • ICC/IF: SK-N-BE cells.
  • General notes

    The clone number has been updated from S34-34 to N34/34, both clone numbers name the same antibody clone.

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.
  • Storage buffer

    pH: 7.40
    Preservative: 0.09% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    N34/34
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab134310 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 65 kDa.
IHC-P Use at an assay dependent concentration.
IHC-Fr Use at an assay dependent concentration.

Target

  • Function

    Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate.
  • Tissue specificity

    Expressed in amygdala, cerebellum, hippocampus, medulla, spinal cord and thalamus.
  • Involvement in disease

    Defects in SLC17A8 are the cause of deafness autosomal dominant type 25 (DFNA25) [MIM:605583]. DFNA25 is a form of sensorineural hearing loss. The expression of DFNA25 deafness is variable in terms of onset and rate of progression, with an age-dependent penetrance resembling an early-onset presbycusis, or senile deafness, a progressive bilateral loss of hearing that occurs in the aged.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Sodium/anion cotransporter family. VGLUT subfamily.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Membrane. Cell junction > synapse > synaptosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • deafness autosomal dominant 25 antibody
    • DFNA 25 antibody
    • DFNA25 antibody
    • SLC17A8 antibody
    • Solute carrier family 17 (sodium dependent inorganic phosphate cotransporter) member 8 antibody
    • Solute carrier family 17 member 8 antibody
    • Vesicular glutamate transporter 3 antibody
    • VGLU3_HUMAN antibody
    • VGLUT 3 antibody
    • VGluT3 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of SK-N-BE (Human neuroblastoma cell line) cells labeling VGLUT3 using ab134310 at 1/100 for 60 minutes at RT. Cells were fixed in 4% formaldehyde for 15 minutes at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1/200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1/1000, 1/5000 for 60 min at RT, 5 min at RT.

  • ab134310 staining VGLUT3 in human tendon tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections).

    Tissue was fixed with 10% formalin and blocked for 5 minutes at room temperature; antigen retrieval was by heat mediation. Samples were incubated with primary antibody (1/250) for 1 hour. An undiluted HRP-conjugated goat anti-mouse IgG polyclonal was used as the secondary antibody.

    See Abreview

References

ab134310 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Rhesus monkey Tissue sections (Brain)
Antigen retrieval step
None
Permeabilization
Yes - 0.4% Triton
Specification
Brain
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 2% · Temperature: 20°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jul 27 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Blocking step
Dako Flex peroxidase as blocking agent for 5 minute(s) · Concentration: 100% · Temperature: RT°C
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: High pH
Sample
Human Tissue sections (Tendon)
Specification
Tendon
Permeabilization
No
Fixative
10% buffered formalin

Abcam user community

Verified customer

Submitted Oct 21 2014

Answer

Thank you for your enquiry.

I can confirm that any publications that we are aware of will be listed on the datasheet. We have a dedicated team who spend time reviewing the literature to find articles that have used our products. However, in many cases, regrettably we do not have access to all the articles mentioning our products, or subscriptions to all the journals that publish them. I'm sorry there are none to provide on this occasion for ab134310.

This antibody has been tested and guaranteed to be used in IHC-Fr. If this product does not work we will be happy to refund your money including the postage cost.

We can provide you 100% Abreview image discount. Please check the terms and conditions first and then contact me with the species and type of tissue section you would be using. e.g. human spleen tissue sections

https://www.abcam.com/index.html?pageconfig=resource&rid=11998&viapagetrap=collaborationdiscount

Should you have any further questions, please do not hesitate to contact us.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up