Overview

  • Product name

  • Description

    Rabbit polyclonal to VHLL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human VHLL aa 1-139.
    Sequence:

    MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNS RELSRIIICNHSPRIVLPVWLNYYGKLLPYLTLLPGRDFRIHNFRSHPWL FRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP


    Database link: Q6RSH7

  • Positive control

    • IHC-P: Human placenta and endometrial cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Functions as a dominant-negative VHL to serve as a protector of HIFalpha.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • VHL like protein antibody
    • VHL pseudogene antibody
    • VHL-like protein antibody
    • VHLL antibody
    • VHLP antibody
    • VLP antibody
    • von Hippel Lindau like protein antibody
    • von Hippel Lindau tumor suppressor like antibody
    • Von Hippel-Lindau-like protein antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for VHLL using ab238681 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrial cancer tissue stained for VHLL using ab238681 at 1/100 dilution in immunohistochemical analysis.

References

ab238681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up