Anti-VILIP1 antibody (ab190372)
Key features and details
- Chicken polyclonal to VILIP1
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Rat, Cow, Human
- Isotype: IgY
Overview
-
Product name
Anti-VILIP1 antibody
See all VILIP1 primary antibodies -
Description
Chicken polyclonal to VILIP1 -
Host species
Chicken -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Cow, Human
Predicted to work with: Chicken, Cynomolgus monkey, Orangutan
-
Immunogen
Recombinant full length protein (His-tag) corresponding to Human VILIP1 aa 1-191. purified from E. coli.
Sequence:MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQ LYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQK LNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQR VDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Database link: P62760 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Do Not Freeze. -
Concentration information loading... -
Purity
IgY fraction -
Clonality
Polyclonal -
Isotype
IgY -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab190372 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/5000 - 1/10000. Predicted molecular weight: 22 kDa. | |
| ICC/IF | 1/1000 - 1/2000. |
Target
-
Function
Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner. -
Tissue specificity
Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level). -
Sequence similarities
Belongs to the recoverin family.
Contains 4 EF-hand domains. - Information by UniProt
-
Database links
- Entrez Gene: 396189 Chicken
- Entrez Gene: 282124 Cow
- Entrez Gene: 7447 Human
- Entrez Gene: 26950 Mouse
- Entrez Gene: 100173440 Orangutan
- Entrez Gene: 24877 Rat
- Omim: 600817 Human
- SwissProt: P62764 Chicken
see all -
Alternative names
- 21 kDa CABP antibody
- Hippocalcin like protein 3 antibody
- Hippocalcin-like protein 3 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-VILIP1 antibody (ab190372)Confocal immunofluorescent analysis of adult rat cerebellar cortex labeling VILIP1 with ab190372 at 1/1000 dilution (green) followed by polyclonal antibody to NF-M (red) and DNA (blue). ML: molecular layer; GC: granule cell layer; PC: Purkinje cells; WM: white matter.
-
Western blot - Anti-VILIP1 antibody (ab190372)All lanes : Anti-VILIP1 antibody (ab190372) at 1/10000 dilution
Lane 1 : Rat brain lysate
Lane 2 : Mouse brain lysate
Lane 3 : Pig hippocampus lysate
Lane 4 : Cow cerebellum lysate
Predicted band size: 22 kDa -
Western blot - Anti-VILIP1 antibody (ab190372)Anti-VILIP1 antibody (ab190372) at 1/5000 dilution + rat brain homogenate
Predicted band size: 22 kDa
Protocols
Datasheets and documents
References (0)
ab190372 has not yet been referenced specifically in any publications.
