Anti-VILIP1 antibody (ab190372)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-VILIP1 antibody
See all VILIP1 primary antibodies -
Description
Chicken polyclonal to VILIP1 -
Host species
Chicken -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Cow, Human
Predicted to work with: Chicken, Cynomolgus monkey, Orangutan -
Immunogen
Recombinant full length protein (His-tag) corresponding to Human VILIP1 aa 1-191. purified from E. coli.
Sequence:MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQ LYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQK LNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQR VDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Database link: P62760 -
Positive control
- WB: Rat brain lysate; mouse brain lysate; Pig hippocampus lysate; Cow cerebellum lysate. IHC-P: Adult rat cerebellar cortex tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Concentration information loading...
-
Purity
IgY fraction -
Clonality
Polyclonal -
Isotype
IgY -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab190372 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/5000 - 1/10000. Predicted molecular weight: 22 kDa. | |
ICC/IF | 1/1000 - 1/2000. | |
IHC-P | Use at an assay dependent concentration. |
Target
-
Function
Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner. -
Tissue specificity
Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level). -
Sequence similarities
Belongs to the recoverin family.
Contains 4 EF-hand domains. - Information by UniProt
-
Database links
- Entrez Gene: 396189 Chicken
- Entrez Gene: 282124 Cow
- Entrez Gene: 7447 Human
- Entrez Gene: 26950 Mouse
- Entrez Gene: 100173440 Orangutan
- Entrez Gene: 24877 Rat
- Omim: 600817 Human
- SwissProt: P62764 Chicken
see all -
Alternative names
- 21 kDa CABP antibody
- Hippocalcin like protein 3 antibody
- Hippocalcin-like protein 3 antibody
see all
Images
-
Confocal immunofluorescent analysis of adult rat cerebellar cortex labeling VILIP1 with ab190372 at 1/1000 dilution (green) followed by polyclonal antibody to NF-M (red) and DNA (blue). ML: molecular layer; GC: granule cell layer; PC: Purkinje cells; WM: white matter.
-
All lanes : Anti-VILIP1 antibody (ab190372) at 1/10000 dilution
Lane 1 : Rat brain lysate
Lane 2 : Mouse brain lysate
Lane 3 : Pig hippocampus lysate
Lane 4 : Cow cerebellum lysate
Predicted band size: 22 kDa -
Anti-VILIP1 antibody (ab190372) at 1/5000 dilution + rat brain homogenate
Predicted band size: 22 kDa
Protocols
Datasheets and documents
References
ab190372 has not yet been referenced specifically in any publications.