Overview

  • Product name

  • Description

    Chicken polyclonal to VILIP1
  • Host species

    Chicken
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Cow, Human
    Predicted to work with: Chicken, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human VILIP1 aa 1-191. purified from E. coli.
    Sequence:

    MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQ LYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQK LNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQR VDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK


    Database link: P62760

  • Positive control

    • WB: Rat brain lysate; mouse brain lysate; Pig hippocampus lysate; Cow cerebellum lysate. IHC-P: Adult rat cerebellar cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab190372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/5000 - 1/10000. Predicted molecular weight: 22 kDa.
ICC/IF 1/1000 - 1/2000.
IHC-P Use at an assay dependent concentration.

Target

Images

  • Confocal immunofluorescent analysis of adult rat cerebellar cortex labeling VILIP1 with ab190372 at 1/1000 dilution (green) followed by polyclonal antibody to NF-M (red) and DNA (blue). ML: molecular layer; GC: granule cell layer; PC: Purkinje cells; WM: white matter.

  • All lanes : Anti-VILIP1 antibody (ab190372) at 1/10000 dilution

    Lane 1 : Rat brain lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : Pig hippocampus lysate
    Lane 4 : Cow cerebellum lysate

    Predicted band size: 22 kDa

  • Anti-VILIP1 antibody (ab190372) at 1/5000 dilution + rat brain homogenate

    Predicted band size: 22 kDa

References

ab190372 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up