Overview

  • Product name

  • Description

    Rabbit polyclonal to VILIP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Cow, Human
    Predicted to work with: Mouse, Rat, Chicken, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human VILIP1 aa 1-191. Purified from E. coli.
    Sequence:

    MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQ LYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQK LNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQR VDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK


    Database link: P62760

  • Positive control

    • Cow cerebellum homogenate; Human brain, cerebellum tissue; Neuron-glia cell culture.

Properties

Applications

Our Abpromise guarantee covers the use of ab211465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC 1/2000.
WB 1/10000. Predicted molecular weight: 22 kDa.
ICC/IF 1/2000.

Target

Images

  • Anti-VILIP1 antibody (ab211465) at 1/10000 dilution + Cow cerebellum homogenate

    Predicted band size: 22 kDa
    Observed band size: 22 kDa

  • Immunofluorescent analysis of Neuron-glia cell culture labeling VILIP1 with ab211465 at 1/2000 dilution (red), monoclonal antibody to GFAP (green) and DNA (blue).

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human brain cerebellum tissue labeling VILIP1 with ab211465 at 1/100 dilution.

References

ab211465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up