Overview

  • Product name

    Anti-Villin antibody [3E5G11] - N-terminal
    See all Villin primary antibodies
  • Description

    Mouse monoclonal [3E5G11] to Villin - N-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Villin aa 1-209 (N terminal).
    Sequence:

    MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILA IHKTASSLSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQ GNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKGKRNVVA GEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQ ERGGRTYVG


    Database link: P09327

  • Positive control

    • Human Villin (AA: 1-209) recombinant protein; Villin (AA: 1-209)-hIgGFc transfected HEK293 (2) cell lysate; SW620 cell lysate; HeLa and SW620 cells; Human cervical cancer tissue
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR286745-12 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab201989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 93 kDa.
ICC/IF 1/200 - 1/1000.

Target

  • Function

    Ca(2+)-regulated actin-binding protein.
  • Tissue specificity

    Major component of microvilli of intestinal epithelial cells and kidney proximal tubule cells.
  • Sequence similarities

    Belongs to the villin/gelsolin family.
    Contains 6 gelsolin-like repeats.
    Contains 1 HP (headpiece) domain.
  • Domain

    Consists of a large core fragment, the N-terminal portion, and a small headpiece, the C-terminal portion. The headpiece binds F-actin strongly in both the presence and absence of calcium.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • D2S1471 antibody
    • OTTHUMP00000164145 antibody
    • VIL antibody
    • VIL1 antibody
    • VILI_HUMAN antibody
    • Villin 1 antibody
    • Villin-1 antibody
    • Villin1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human cervical cancer tissue labeling Villin with ab201989 at 1/200 dilution.

  • Flow cytometric analysis of SW620 cells using ab201989 at 1/200 dilution (green) and negative control (red).

  • Immunofluorescence analysis of Hela cells using ab201989 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.

  • Anti-Villin antibody [3E5G11] - N-terminal (ab201989) at 1/500 dilution + SW620 cell lysate

    Predicted band size: 93 kDa

  • All lanes : Anti-Villin antibody [3E5G11] - N-terminal (ab201989) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Villin (AA: 1-209)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 93 kDa

  • Anti-Villin antibody [3E5G11] - N-terminal (ab201989) at 1/500 dilution + Human Villin (AA: 1-209) recombinant protein

    Predicted band size: 93 kDa

References

This product has been referenced in:

  • Wilke G  et al. A Stem-Cell-Derived Platform Enables Complete Cryptosporidium Development In Vitro and Genetic Tractability. Cell Host Microbe 26:123-134.e8 (2019). Read more (PubMed: 31231046) »
See 1 Publication for this product

Customer reviews and Q&As

1-5 of 5 Abreviews or Q&A

Application
Flow Cytometry
Sample
Mouse Cell (Intestinal epithelium)
Permeabilization
Yes - PBS + Triton 0,2%
Gating Strategy
Live cells
Specification
Intestinal epithelium
Fixation
Methanol

Abcam user community

Verified customer

Submitted Sep 20 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Mouse small intestine)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Sodium citrate 10 mM pH=6
Permeabilization
Yes - PBS + Triton 0,2%
Specification
Mouse small intestine
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 8% · Temperature: RT°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Sep 20 2018

Application
Flow Cytometry
Sample
Human Cell (Caco2 cell line)
Permeabilization
Yes - PBS + Triton 0,2%
Gating Strategy
Live cells
Specification
Caco2 cell line
Fixation
Methanol

Abcam user community

Verified customer

Submitted Sep 20 2018

Application
Immunohistochemistry (Frozen sections)
Sample
Cow Tissue sections (jejunum)
Permeabilization
No
Specification
jejunum
Fixative
heat (67C, 15 min)

Abcam user community

Verified customer

Submitted Jun 21 2018

Application
Immunohistochemistry (Frozen sections)
Sample
Pig Tissue sections (jejunum)
Permeabilization
No
Specification
jejunum
Fixative
heat (67C, 15 min)

Abcam user community

Verified customer

Submitted Jun 11 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up