Overview

  • Product name

    Anti-Villin antibody [5E3B2]
    See all Villin primary antibodies
  • Description

    Mouse monoclonal [5E3B2] to Villin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Villin aa 1-209. Expressed in E. Coli.
    Sequence:

    MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILA IHKTASSLSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQ GNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKGKRNVVA GEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQ ERGGRTYVG


    Database link: P09327

  • Positive control

    • Recombinant fragment of Villin (aa 1-209); Villin (aa: 1-209)-hIgGFc transfected HEK293 cell lysate; Human muscle and stomach cancer tissues

Properties

Applications

Our Abpromise guarantee covers the use of ab202021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 93 kDa.
IHC-P 1/200 - 1/1000.

Target

  • Function

    Ca(2+)-regulated actin-binding protein.
  • Tissue specificity

    Major component of microvilli of intestinal epithelial cells and kidney proximal tubule cells.
  • Sequence similarities

    Belongs to the villin/gelsolin family.
    Contains 6 gelsolin-like repeats.
    Contains 1 HP (headpiece) domain.
  • Domain

    Consists of a large core fragment, the N-terminal portion, and a small headpiece, the C-terminal portion. The headpiece binds F-actin strongly in both the presence and absence of calcium.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • D2S1471 antibody
    • OTTHUMP00000164145 antibody
    • VIL antibody
    • VIL1 antibody
    • VILI_HUMAN antibody
    • Villin 1 antibody
    • Villin-1 antibody
    • Villin1 antibody
    see all

Images

  • Anti-Villin antibody [5E3B2] (ab202021) at 1/500 dilution + Recombinant fragment of Villin (aa 1-209) at 1 µg

    Predicted band size: 93 kDa



    Expected MW is 49 kDa

  • All lanes : Anti-Villin antibody [5E3B2] (ab202021) at 1/500 dilution

    Lane 1 : Non transfected HEK293 cell lysate
    Lane 2 : Villin (aa: 1-209)-hIgGFc transfected HEK293 cell lysate

    Lysates/proteins at 1 µg per lane.

    Predicted band size: 93 kDa

  • Immunohistochemical analysis of paraffin embedded Human muscle tissue labeling Villin using ab202021 at 1/200 dilution, followed by DAB staining.

  • Immunohistochemical analysis of paraffin embedded Human stomach cancer tissue labeling Villin using ab202021 at 1/200 dilution, followed by DAB staining.

References

ab202021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up