Overview

  • Product name

  • Description

    Rabbit polyclonal to Villin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Villin aa 1-320. Expressed in E. coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-MTKLSAQVKGSLN ITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIH YWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQ GLVIRKGGVASGMKHVETNSYDVQRLLHVKGKRNVVAGEVEMSWKSFNRG DVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDG ENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEG NLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMS HALNFIK


    Database link: P09327

  • Positive control

    • IHC-P: Human prostate, prostate cancer, stomach cancer, pancreatic cancer and breast cancer tissue. WB: Recombinant human Villin protein. Mouse kidney and pig liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 93 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Ca(2+)-regulated actin-binding protein.
  • Tissue specificity

    Major component of microvilli of intestinal epithelial cells and kidney proximal tubule cells.
  • Sequence similarities

    Belongs to the villin/gelsolin family.
    Contains 6 gelsolin-like repeats.
    Contains 1 HP (headpiece) domain.
  • Domain

    Consists of a large core fragment, the N-terminal portion, and a small headpiece, the C-terminal portion. The headpiece binds F-actin strongly in both the presence and absence of calcium.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • D2S1471 antibody
    • OTTHUMP00000164145 antibody
    • VIL antibody
    • VIL1 antibody
    • VILI_HUMAN antibody
    • Villin 1 antibody
    • Villin-1 antibody
    • Villin1 antibody
    see all

Images

  • All lanes : Anti-Villin antibody (ab233155) at 3 µg/ml

    Lane 1 : Mouse kidney tissue lysate
    Lane 2 : Pig liver tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 93 kDa

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Villin with ab233155 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for Villin with ab233155 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for Villin with ab233155 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for Villin with ab233155 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for Villin with ab233155 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-Villin antibody (ab233155) at 3 µg/ml + Recombinant human Villin protein

    Predicted band size: 93 kDa

References

ab233155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up