Overview

  • Product name

  • Description

    Rabbit polyclonal to Villin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Villin aa 716-823.
    Sequence:

    PFKWSNTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLP IFPLEQLVNKPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRW KQQNLKKE


    Database link: P09327

  • Positive control

    • IHC-P: Human kidney, small intestine, pancreas, colon, gallbladder and liver tissues. WB: Caco-2 cell lysate. ICC/IF: Caco-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 97 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Ca(2+)-regulated actin-binding protein.
  • Tissue specificity

    Major component of microvilli of intestinal epithelial cells and kidney proximal tubule cells.
  • Sequence similarities

    Belongs to the villin/gelsolin family.
    Contains 6 gelsolin-like repeats.
    Contains 1 HP (headpiece) domain.
  • Domain

    Consists of a large core fragment, the N-terminal portion, and a small headpiece, the C-terminal portion. The headpiece binds F-actin strongly in both the presence and absence of calcium.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • D2S1471 antibody
    • OTTHUMP00000164145 antibody
    • VIL antibody
    • VIL1 antibody
    • VILI_HUMAN antibody
    • Villin 1 antibody
    • Villin-1 antibody
    • Villin1 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for Villin using ab244291 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized Caco-2 (human colorectal adenocarcinoma cell line) cells stained for Villin (green) using ab244291 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-Villin antibody (ab244291) at 0.4 µg/ml

    Lane 1 : Caco-2 (human colorectal adenocarcinoma cell line) cell lysate
    Lane 2 : PC-3 (human prostate adenocarcinoma cell line) cell lysate

    Predicted band size: 97 kDa

  • Paraffin-embedded human liver tissue stained for Villin using ab244291 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gallbladder tissue stained for Villin using ab244291 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon tissue stained for Villin using ab244291 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for Villin using ab244291 at 1/50 dilution in immunohistochemical analysis.

    Negative control.

  • Paraffin-embedded human pancreas tissue stained for Villin using ab244291 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for Villin using ab244291 at 1/50 dilution in immunohistochemical analysis.

References

ab244291 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up