Overview

  • Product name
  • Description
    Sheep polyclonal to VIP
  • Host species
    Sheep
  • Specificity
    The reactivity against other peptides has not been examined.
  • Tested applications
    Suitable for: IHC-Fr, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Rabbit, Guinea pig, Cow, Dog, Human, Pig
  • Immunogen

    Synthetic peptide:

    H-HSDAVFTDNYTRLRKQMAVKKYLNSILNQ

    conjugated to KLH by a Glutaraldehyde linker, corresponding to amino acids 45-72 of Pig VIP.

  • General notes
    Excellent antibody for immunohistochemistry for both the peripheral and central nervous system.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Add glycerol to a final volume of 50% for extra stability and aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab6184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr 1/1000.
IHC-P 1/1000.

Target

References

ab6184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-8 of 8 Abreviews or Q&A

Application
Immunohistochemistry (Frozen sections)
Sample
Rat Tissue sections (brain)
Specification
brain
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 10%

Abcam user community

Verified customer

Submitted Oct 11 2006

Answer

Thank you for your enquiry. To our knowledge this antibody has yet to be used in this application. All the information we have available is that which is listed on the product datasheets. We have no further information about this application. Best of luck with your research.

Read More

Answer

Thank you fo your patience. We now have an answer to your initial enquiry.We can confirm that the antisera is suitable for use in all species identified on the datasheet, ie, Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig and Rabbit. The statement "Specificity has not been examined, but results from immunohistochemistry indicate reactivity is similar to findings using other VIP antisera" has been included on the datasheet to indicate that reactivity against other peptides has not been examined. For example, some VIP antisera appear to react with PACAP. However, our antiserum is a high-quality reagent that has been used extensively by many groups and provides results consistent with the accepted distribution of VIP throughout the nervous system, particularly sympathetic and sensory neurons. I hope this helps you with your research.

Read More

Question
Answer

We have not tested this antibody in chick.

Read More

Answer

As far as we are aware, the antibody has only been tested using Zamboni's, so we do not know if it will work with paraffin embedded tissues. The work with rabbit was carried out by the antibody's originators, a research lab in Australia, however it has not been published so we don't have a reference for this.

Read More

Answer

The fixative used for this antibody is Zamboni's (buffered 4% paraformaldehyde with 15% picric acid). Sympathetic and enteric nerve fibres stain particularly well, cell bodies are visible but less intensely stained.

Read More

Answer

We can assure you that this antibody is in routine use for guinea-pig enteric and sympathetic nervous system and with Zamboni's fixative. Several secondary antibodies are used and found appropriate.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up