Overview

  • Product name

  • Description

    Rabbit polyclonal to VIP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human VIP2 aa 897-974.
    Sequence:

    AKGCEEDKNLPSGYGYRPASRENEGRRPFKIDNDDEPHTSKRDEVDRAVI LFKPMVSEPIHIHRKSPLPRSRKTATND


    Database link: O43314

  • Positive control

    • Human hippocampus tissue; U-2OS cells.
  • General notes

    Previously labelled as PPIP5K2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab204374 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Bifunctional inositol kinase that catalyzes the formation of diphosphoinositol pentakisphosphate (InsP7 or PP-InsP5) and bi-diphosphoinositol tetrakisphosphate (InsP8 or PP2-InsP4). Converts inositolitol hexakisphosphate (InsP6) to InsP7. Also able to convert InsP7 to InsP8. Probably specifically mediates the formation of 4PP-InsP5 and 6PP-InsP5 InsP7 isomers but not of 5PP-IP5 InsP7 isomer.
  • Sequence similarities

    Belongs to the histidine acid phosphatase family. VIP1 subfamily.
  • Cellular localization

    Cytoplasm > cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • Diphosphoinositol pentakisphosphate kinase 2 antibody
    • HISPPD1 antibody
    • Histidine acid phosphatase domain containing 1 antibody
    • Histidine acid phosphatase domain containing protein 1 antibody
    • Histidine acid phosphatase domain-containing protein 1 antibody
    • hsVIP2 antibody
    • Inositol heptaphosphate kinase 2 antibody
    • Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 antibody
    • InsP6 and PP IP5 kinase 2 antibody
    • InsP6 and PP-IP5 kinase 2 antibody
    • IP7K2 antibody
    • PP IP5 kinase 2 antibody
    • Ppip5k2 antibody
    • VIP1 homolog 2 antibody
    • VIP2 antibody
    • VIP2_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of Human paraffin-embedded hippocampus tissue labeling VIP2 with ab204374 at 1/1000 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2OS cells labeling VIP2 with ab204374 at 4 µg/ml (green).

References

ab204374 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204374.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up